SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120012.Seq
         (701 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U41272-4|AAA82448.2|  349|Caenorhabditis elegans Hypothetical pr...    30   1.4  
U80023-2|AAG24035.1|  204|Caenorhabditis elegans Hypothetical pr...    30   1.8  
U97592-4|AAB52872.1|  450|Caenorhabditis elegans Hypothetical pr...    29   2.4  
EF584656-1|ABQ57414.1|  500|Caenorhabditis elegans LAD-2 short i...    29   2.4  
EF584655-1|ABQ57413.1| 1187|Caenorhabditis elegans LAD-2 long is...    29   2.4  
AF456361-1|AAL60232.1| 1187|Caenorhabditis elegans immunoglobuli...    29   2.4  
AC024817-51|AAP68914.1|  496|Caenorhabditis elegans L1 cam adhes...    29   2.4  
AC024817-49|AAF59572.3| 1187|Caenorhabditis elegans L1 cam adhes...    29   2.4  
Z81116-13|CAB03300.1|  245|Caenorhabditis elegans Hypothetical p...    29   4.3  
Z22179-17|CAA80171.2|  691|Caenorhabditis elegans Hypothetical p...    29   4.3  
Z22173-3|CAA80127.2|  691|Caenorhabditis elegans Hypothetical pr...    29   4.3  
U41532-4|AAK68320.1|  767|Caenorhabditis elegans Hypothetical pr...    29   4.3  
U41532-3|AAK68319.1|  797|Caenorhabditis elegans Hypothetical pr...    29   4.3  
U64861-2|AAB04994.1|  117|Caenorhabditis elegans Hypothetical pr...    28   5.6  
Z81533-4|CAB04338.1|  280|Caenorhabditis elegans Hypothetical pr...    27   9.8  
Z81051-12|CAB02861.2|  228|Caenorhabditis elegans Hypothetical p...    27   9.8  

>U41272-4|AAA82448.2|  349|Caenorhabditis elegans Hypothetical
           protein T03G11.3 protein.
          Length = 349

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +3

Query: 162 KYGNCKDAVSRHVDKKYKYTYSESGARLPPSLQTAWQSKAIRC-ICSR 302
           ++GN  DAVS    K+  Y   ++GA LPP  +TA  S  ++C  CSR
Sbjct: 94  RHGNFIDAVSS--SKRVDYAL-KTGAPLPPPPKTAVPSDYVQCEYCSR 138


>U80023-2|AAG24035.1|  204|Caenorhabditis elegans Hypothetical
           protein F07C4.6 protein.
          Length = 204

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = -2

Query: 127 TCGFPC-SSTYLSVNVSWPNLNCPILT*AILI 35
           TCG  C +STY   N  +P LNC  +T A+ +
Sbjct: 104 TCGLCCQTSTYSCQNAPFPRLNCASVTKAMCL 135


>U97592-4|AAB52872.1|  450|Caenorhabditis elegans Hypothetical
           protein C14A11.5 protein.
          Length = 450

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 12/39 (30%), Positives = 22/39 (56%)
 Frame = +3

Query: 165 YGNCKDAVSRHVDKKYKYTYSESGARLPPSLQTAWQSKA 281
           YGNCK+++   V++KY   + +    L   L+  W S++
Sbjct: 322 YGNCKESIRSRVEEKYNQLFIDRIRELTEKLE--WSSES 358


>EF584656-1|ABQ57414.1|  500|Caenorhabditis elegans LAD-2 short
           isoform protein.
          Length = 500

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = -1

Query: 200 HVSAYSVFTISIF*TAGDVLGHKLDLRVSLLEHVPQR 90
           H   Y  F  +IF TA   L +K+ LR+  LEH P+R
Sbjct: 98  HQGYYQCFASNIFGTA---LSNKMHLRLGSLEHFPKR 131


>EF584655-1|ABQ57413.1| 1187|Caenorhabditis elegans LAD-2 long
           isoform protein.
          Length = 1187

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = -1

Query: 200 HVSAYSVFTISIF*TAGDVLGHKLDLRVSLLEHVPQR 90
           H   Y  F  +IF TA   L +K+ LR+  LEH P+R
Sbjct: 98  HQGYYQCFASNIFGTA---LSNKMHLRLGSLEHFPKR 131


>AF456361-1|AAL60232.1| 1187|Caenorhabditis elegans immunoglobulin
           domain-containingprotein Y54G2A.25 protein.
          Length = 1187

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = -1

Query: 200 HVSAYSVFTISIF*TAGDVLGHKLDLRVSLLEHVPQR 90
           H   Y  F  +IF TA   L +K+ LR+  LEH P+R
Sbjct: 98  HQGYYQCFASNIFGTA---LSNKMHLRLGSLEHFPKR 131


>AC024817-51|AAP68914.1|  496|Caenorhabditis elegans L1 cam adhesion
           molecule homologprotein 2, isoform b protein.
          Length = 496

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = -1

Query: 200 HVSAYSVFTISIF*TAGDVLGHKLDLRVSLLEHVPQR 90
           H   Y  F  +IF TA   L +K+ LR+  LEH P+R
Sbjct: 98  HQGYYQCFASNIFGTA---LSNKMHLRLGSLEHFPKR 131


>AC024817-49|AAF59572.3| 1187|Caenorhabditis elegans L1 cam adhesion
           molecule homologprotein 2, isoform a protein.
          Length = 1187

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = -1

Query: 200 HVSAYSVFTISIF*TAGDVLGHKLDLRVSLLEHVPQR 90
           H   Y  F  +IF TA   L +K+ LR+  LEH P+R
Sbjct: 98  HQGYYQCFASNIFGTA---LSNKMHLRLGSLEHFPKR 131


>Z81116-13|CAB03300.1|  245|Caenorhabditis elegans Hypothetical
           protein T06C12.14 protein.
          Length = 245

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%)
 Frame = -2

Query: 124 CGFPC-SSTYLSVNVSWPNLNCPILT 50
           CG  C +S+Y   NV++P LNC  +T
Sbjct: 105 CGLCCQTSSYSCPNVAFPRLNCATIT 130


>Z22179-17|CAA80171.2|  691|Caenorhabditis elegans Hypothetical
           protein F58A4.11 protein.
          Length = 691

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = -3

Query: 387 SHSCNSMAYGSLLFIIN*ITPDLVISTVCGCKYSGSPCFATLFGARAVVSPPTR 226
           S + N   +   L  +N +TP L ++   G     SPC  T   A +V S PT+
Sbjct: 138 SAAFNQQLFKQTLANLNTVTPQLPVNIPTGLPMPASPC-TTAASAPSVESTPTK 190


>Z22173-3|CAA80127.2|  691|Caenorhabditis elegans Hypothetical
           protein F58A4.11 protein.
          Length = 691

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = -3

Query: 387 SHSCNSMAYGSLLFIIN*ITPDLVISTVCGCKYSGSPCFATLFGARAVVSPPTR 226
           S + N   +   L  +N +TP L ++   G     SPC  T   A +V S PT+
Sbjct: 138 SAAFNQQLFKQTLANLNTVTPQLPVNIPTGLPMPASPC-TTAASAPSVESTPTK 190


>U41532-4|AAK68320.1|  767|Caenorhabditis elegans Hypothetical
           protein F11D5.3b protein.
          Length = 767

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 201 PRVCLQRLYNFHILNCW 151
           PR+C  +LYN  IL CW
Sbjct: 722 PRMCPSKLYNEQILPCW 738


>U41532-3|AAK68319.1|  797|Caenorhabditis elegans Hypothetical
           protein F11D5.3a protein.
          Length = 797

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 201 PRVCLQRLYNFHILNCW 151
           PR+C  +LYN  IL CW
Sbjct: 752 PRMCPSKLYNEQILPCW 768


>U64861-2|AAB04994.1|  117|Caenorhabditis elegans Hypothetical
           protein C47D2.1 protein.
          Length = 117

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = +3

Query: 213 KYTYSESGARLPPSLQTAWQSKAIRCICSRIQCLL 317
           K+ Y+     L    Q+ WQS    C  S +QCLL
Sbjct: 67  KFQYTGRNQILEKRPQSPWQSPLRNCYLSPVQCLL 101


>Z81533-4|CAB04338.1|  280|Caenorhabditis elegans Hypothetical
           protein F36G9.7 protein.
          Length = 280

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = -2

Query: 172 FPYFKLLAMSLATNLTCGFPCSSTYLSVNVSW 77
           FPY++ L     TNLTC    +S ++ VNVS+
Sbjct: 241 FPYYEYLCTHYWTNLTC---YTSIFVFVNVSF 269


>Z81051-12|CAB02861.2|  228|Caenorhabditis elegans Hypothetical
           protein C55A6.1 protein.
          Length = 228

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 493 IYRAHNALQGWWRKKPRNFLKSKSLSNA 576
           IY   N  QGWWR +PRN  + +   NA
Sbjct: 114 IYSGKN--QGWWRFEPRNEREIEEAYNA 139


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,545,291
Number of Sequences: 27780
Number of extensions: 317974
Number of successful extensions: 820
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 779
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 815
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1624019012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -