SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120009.Seq
         (721 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81062-3|CAB02948.2|  325|Caenorhabditis elegans Hypothetical pr...    29   4.4  
AC006607-6|AAF60370.2|  496|Caenorhabditis elegans Hypothetical ...    28   5.8  
Z49071-1|CAA88873.2|  269|Caenorhabditis elegans Hypothetical pr...    28   7.7  
AL034489-5|CAA22467.1|  383|Caenorhabditis elegans Hypothetical ...    28   7.7  

>Z81062-3|CAB02948.2|  325|Caenorhabditis elegans Hypothetical
           protein F15A4.4 protein.
          Length = 325

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = +3

Query: 3   MFCTVCLKDRNYYMFKLF 56
           +FC VCLK+R Y +F+ F
Sbjct: 252 VFCEVCLKNRLYLLFQFF 269


>AC006607-6|AAF60370.2|  496|Caenorhabditis elegans Hypothetical
           protein C09E7.5 protein.
          Length = 496

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 15/52 (28%), Positives = 23/52 (44%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           TEC ICLE++ +        +T      + FH +C  +W  E    P  R +
Sbjct: 440 TECAICLEEMYN------FKETIKCECRRRFHSKCATKWLNEKRECPTCRKL 485


>Z49071-1|CAA88873.2|  269|Caenorhabditis elegans Hypothetical
           protein T22C8.1 protein.
          Length = 269

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = -3

Query: 305 TLWFLEASRCIPLAFLGKVKIIFYSTIKR 219
           T +F  +S C+P+A LG   +IF   +K+
Sbjct: 103 TKFFTLSSTCLPIAMLGMYLVIFIFIVKK 131


>AL034489-5|CAA22467.1|  383|Caenorhabditis elegans Hypothetical
           protein Y7A5A.7 protein.
          Length = 383

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%)
 Frame = +2

Query: 326 DCVYK--RVYQRVTQEDALDIELDFRNFFKKCNHDE 427
           DC+ K  R YQ+   +D  D    F   +KKC  D+
Sbjct: 226 DCILKSTRSYQKQATKDIEDKRTIFNALYKKCEEDQ 261


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,924,482
Number of Sequences: 27780
Number of extensions: 335074
Number of successful extensions: 822
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 798
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 820
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1687292480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -