SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120008.Seq
         (681 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81555-7|CAB04518.1|  561|Caenorhabditis elegans Hypothetical pr...   136   1e-32
Z81449-4|CAB03765.1|  811|Caenorhabditis elegans Hypothetical pr...    96   2e-20
AC024810-3|AAU20831.1|  660|Caenorhabditis elegans Vasa- and bel...    96   2e-20
AC024810-2|AAK68520.1|  644|Caenorhabditis elegans Vasa- and bel...    96   2e-20
AC024810-1|AAF60764.1|  641|Caenorhabditis elegans Vasa- and bel...    96   2e-20
AF045641-1|AAK68386.1|  970|Caenorhabditis elegans Hypothetical ...    93   1e-19
AL034488-3|CAA22456.1|  504|Caenorhabditis elegans Hypothetical ...    91   7e-19
AC024859-14|AAY43989.1|  643|Caenorhabditis elegans Hypothetical...    91   9e-19
AC006665-5|AAF39907.1|  630|Caenorhabditis elegans Hypothetical ...    83   2e-16
U13070-1|AAK67224.1|  730|Caenorhabditis elegans Hypothetical pr...    80   1e-15
AF079509-1|AAC28388.1|  720|Caenorhabditis elegans germline RNA ...    69   4e-12
AF003145-4|AAB57719.1|  720|Caenorhabditis elegans Germ-line hel...    69   4e-12
U62772-1|AAB04136.1|  763|Caenorhabditis elegans RNA helicase pr...    66   3e-11
U60449-1|AAB03510.1|  974|Caenorhabditis elegans GLH-2 protein.        66   3e-11
U60194-1|AAB03337.1|  974|Caenorhabditis elegans RNA helicase GL...    66   3e-11
L19948-1|AAC27384.1|  763|Caenorhabditis elegans RNA helicase pr...    66   3e-11
AF000197-1|AAB52901.2|  763|Caenorhabditis elegans Germ-line hel...    66   3e-11
AC006625-11|AAK68269.1|  974|Caenorhabditis elegans Germ-line he...    66   3e-11
AC006605-1|AAK85443.1|  430|Caenorhabditis elegans Conserved ger...    66   3e-11
Z29115-1|CAA82362.1|  489|Caenorhabditis elegans Hypothetical pr...    64   7e-11
AC024753-1|AAF60456.1|  732|Caenorhabditis elegans Hypothetical ...    63   2e-10
U13876-12|AAA21169.1|  363|Caenorhabditis elegans Hypothetical p...    59   3e-09
AF039720-12|AAB96704.1|  399|Caenorhabditis elegans Hypothetical...    58   8e-09
AC024844-2|AAK29954.2|  399|Caenorhabditis elegans Hypothetical ...    58   8e-09
AC024876-4|AAU05555.1|  825|Caenorhabditis elegans Hypothetical ...    57   1e-08
AC024876-3|AAU05556.1|  871|Caenorhabditis elegans Hypothetical ...    57   1e-08
Z12116-1|CAA78102.1|  402|Caenorhabditis elegans protein ( C.ele...    56   2e-08
U13876-3|AAA21170.1|  402|Caenorhabditis elegans Initiation fact...    56   2e-08
EU051652-1|ABS85191.1|  973|Caenorhabditis elegans MEL-46 protein.     55   4e-08
CU457744-1|CAM36366.2|  973|Caenorhabditis elegans Hypothetical ...    55   4e-08
AF067608-1|AAC17654.2|  544|Caenorhabditis elegans Hypothetical ...    52   3e-07
Z54327-6|CAA91120.1|  425|Caenorhabditis elegans Hypothetical pr...    52   4e-07
Z81094-7|CAB03153.2|  960|Caenorhabditis elegans Hypothetical pr...    51   9e-07
Z54327-7|CAD57690.1|  268|Caenorhabditis elegans Hypothetical pr...    50   1e-06
AC006661-5|AAF39890.2|  488|Caenorhabditis elegans Hypothetical ...    50   1e-06
AC006661-4|ABB88208.1|  561|Caenorhabditis elegans Hypothetical ...    50   1e-06
AC025726-23|AAK73934.1|  763|Caenorhabditis elegans Hypothetical...    50   2e-06
AF079508-1|AAC28387.1| 1156|Caenorhabditis elegans germline RNA ...    48   6e-06
AF039718-2|AAB96745.2| 1156|Caenorhabditis elegans Germ-line hel...    48   6e-06
U08102-1|AAB65852.1|  417|Caenorhabditis elegans putative RNA he...    46   2e-05
U80447-2|AAO38637.1|  579|Caenorhabditis elegans Hypothetical pr...    44   1e-04
U80447-1|AAB37806.1|  746|Caenorhabditis elegans Hypothetical pr...    44   1e-04
Z22177-1|CAA80151.1|  578|Caenorhabditis elegans Hypothetical pr...    43   2e-04
AF025451-4|AAL16306.1|  567|Caenorhabditis elegans Hypothetical ...    43   2e-04
AF025451-3|AAB71200.2|  634|Caenorhabditis elegans Hypothetical ...    43   2e-04
U64840-7|AAB04965.1|  340|Caenorhabditis elegans Hypothetical pr...    39   0.004
U53141-4|AAA96106.1|  528|Caenorhabditis elegans Mutator protein...    39   0.004
Z92785-2|CAB07200.1|  344|Caenorhabditis elegans Hypothetical pr...    33   0.25 
Z75546-3|CAA99891.1|  581|Caenorhabditis elegans Hypothetical pr...    32   0.33 
L17337-1|AAP68928.1|  593|Caenorhabditis elegans Hypothetical pr...    32   0.33 
AF125963-6|AAK95885.1|  520|Caenorhabditis elegans Hypothetical ...    32   0.33 
Z81481-6|CAB63435.1|  344|Caenorhabditis elegans Hypothetical pr...    32   0.44 
Z50071-3|CAA90407.1|  613|Caenorhabditis elegans Hypothetical pr...    31   1.0  
Z50071-2|CAA90406.1|  638|Caenorhabditis elegans Hypothetical pr...    31   1.0  
Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical pr...    31   1.0  
U40933-4|AAA81674.1|  778|Caenorhabditis elegans Caenorhabditis ...    29   3.1  
AF100656-7|AAF99964.2|  615|Caenorhabditis elegans Hypothetical ...    29   4.1  
Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical pr...    27   9.4  
M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL receptor-re...    27   9.4  
AL021175-8|CAA15970.2|  201|Caenorhabditis elegans Hypothetical ...    27   9.4  
AL021175-7|CAE54921.1|  329|Caenorhabditis elegans Hypothetical ...    27   9.4  

>Z81555-7|CAB04518.1|  561|Caenorhabditis elegans Hypothetical
           protein F58E10.3a protein.
          Length = 561

 Score =  136 bits (330), Expect = 1e-32
 Identities = 61/84 (72%), Positives = 75/84 (89%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+DFL+ GTTN+++C+YLVLDEADRMLDMGFEPQI+KII QIRPDRQTLM+SATWPKE
Sbjct: 261 GRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKE 320

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V+ LA D+  D   +N+GSL+L+A
Sbjct: 321 VRALASDFQKDAAFLNVGSLELAA 344



 Score =  116 bits (279), Expect = 2e-26
 Identities = 54/84 (64%), Positives = 68/84 (80%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LPA+VHI  Q   +RG+GP  LVL PTRELAQQ+Q+V+ DF H+  ++ TC
Sbjct: 176 GSGKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTC 235

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           +FGGA K  QARDLERGV+IV+AT
Sbjct: 236 LFGGASKGPQARDLERGVDIVVAT 259



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 28/46 (60%), Positives = 32/46 (69%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNI Q+VDI +EH K+ KL  LL  I   +E   KTIIFVETKRK
Sbjct: 345 NHNITQVVDILEEHAKQAKLMELLNHIMNQKE--CKTIIFVETKRK 388


>Z81449-4|CAB03765.1|  811|Caenorhabditis elegans Hypothetical
           protein C46F11.4 protein.
          Length = 811

 Score = 96.3 bits (229), Expect = 2e-20
 Identities = 45/90 (50%), Positives = 63/90 (70%)
 Frame = +2

Query: 227 EGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQT 406
           EG+    C  GR+ID ++ G TN  R T+LV DEADRM DMGFE Q++ I + +RPDRQ 
Sbjct: 388 EGAEMVVCTPGRIIDLVKMGATNFLRTTFLVFDEADRMFDMGFEAQVKSISDHVRPDRQC 447

Query: 407 LMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           LM+SAT+ ++V++LA D L D ++I  G +
Sbjct: 448 LMFSATFKQKVERLARDALVDPVRIVQGEV 477



 Score = 86.6 bits (205), Expect = 1e-17
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT AY+ PAIVHI +QP ++ G+GP+A+++ PTRELA Q+ Q A  F     +   C
Sbjct: 312 GSGKTAAYLWPAIVHIMDQPDLKAGEGPVAVIVVPTRELAIQVFQEAKKFCKVYNINPIC 371

Query: 183 VFGGAPKREQARDLE-RGVEIVIAT 254
            +GG  K EQ+ +L+  G E+V+ T
Sbjct: 372 AYGGGSKWEQSNELQNEGAEMVVCT 396


>AC024810-3|AAU20831.1|  660|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform c protein.
          Length = 660

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 50/82 (60%), Positives = 61/82 (74%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSATW 427
           GRLID +E+G   L  C YLVLDEADRMLDMGFEPQIRKI+ Q  P    R T M+SAT+
Sbjct: 282 GRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQGMPPKTARTTAMFSATF 341

Query: 428 PKEVKKLAEDYLGD-YIQINIG 490
           PKE++ LA+D+L D YI + +G
Sbjct: 342 PKEIQVLAKDFLKDNYIFLAVG 363



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 41/95 (43%), Positives = 53/95 (55%), Gaps = 11/95 (11%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN------QPPI----RRGDGPIALVLAPTRELAQQIQQVAADF 152
           GSGKT A++LP I HI        +PP     RR   P ALVL+PTRELA QI + A  F
Sbjct: 186 GSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKF 245

Query: 153 GHTSYVRNTCVFGGAPK-REQARDLERGVEIVIAT 254
            + S ++   ++GG    R+Q   L  G  I+IAT
Sbjct: 246 SYKSNIQTAILYGGRENYRDQVNRLRAGTHILIAT 280


>AC024810-2|AAK68520.1|  644|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform b protein.
          Length = 644

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 50/82 (60%), Positives = 61/82 (74%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSATW 427
           GRLID +E+G   L  C YLVLDEADRMLDMGFEPQIRKI+ Q  P    R T M+SAT+
Sbjct: 266 GRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQGMPPKTARTTAMFSATF 325

Query: 428 PKEVKKLAEDYLGD-YIQINIG 490
           PKE++ LA+D+L D YI + +G
Sbjct: 326 PKEIQVLAKDFLKDNYIFLAVG 347



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 41/95 (43%), Positives = 53/95 (55%), Gaps = 11/95 (11%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN------QPPI----RRGDGPIALVLAPTRELAQQIQQVAADF 152
           GSGKT A++LP I HI        +PP     RR   P ALVL+PTRELA QI + A  F
Sbjct: 170 GSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKF 229

Query: 153 GHTSYVRNTCVFGGAPK-REQARDLERGVEIVIAT 254
            + S ++   ++GG    R+Q   L  G  I+IAT
Sbjct: 230 SYKSNIQTAILYGGRENYRDQVNRLRAGTHILIAT 264


>AC024810-1|AAF60764.1|  641|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform a protein.
          Length = 641

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 50/82 (60%), Positives = 61/82 (74%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSATW 427
           GRLID +E+G   L  C YLVLDEADRMLDMGFEPQIRKI+ Q  P    R T M+SAT+
Sbjct: 263 GRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQGMPPKTARTTAMFSATF 322

Query: 428 PKEVKKLAEDYLGD-YIQINIG 490
           PKE++ LA+D+L D YI + +G
Sbjct: 323 PKEIQVLAKDFLKDNYIFLAVG 344



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 41/95 (43%), Positives = 53/95 (55%), Gaps = 11/95 (11%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN------QPPI----RRGDGPIALVLAPTRELAQQIQQVAADF 152
           GSGKT A++LP I HI        +PP     RR   P ALVL+PTRELA QI + A  F
Sbjct: 167 GSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKF 226

Query: 153 GHTSYVRNTCVFGGAPK-REQARDLERGVEIVIAT 254
            + S ++   ++GG    R+Q   L  G  I+IAT
Sbjct: 227 SYKSNIQTAILYGGRENYRDQVNRLRAGTHILIAT 261


>AF045641-1|AAK68386.1|  970|Caenorhabditis elegans Hypothetical
           protein F53H1.1 protein.
          Length = 970

 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 46/93 (49%), Positives = 63/93 (67%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R TYLVLDEADRM D GFEPQI K++  IR
Sbjct: 424 LKRGAEIVVCTPGRMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVNNIR 483

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PD+QT+++SAT+P+ ++ LA   L   ++I +G
Sbjct: 484 PDKQTVLFSATFPRHMEALARKVLDKPVEILVG 516



 Score = 90.6 bits (215), Expect = 9e-19
 Identities = 43/84 (51%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LP   HI +QP +  GDGPIA++LAPTRELA Q  + A  F     ++  C
Sbjct: 351 GSGKTLAFLLPMFRHILDQPELEEGDGPIAVILAPTRELAMQTYKEANKFAKPLGLKVAC 410

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +GG    EQ  DL+RG EIV+ T
Sbjct: 411 TYGGVGISEQIADLKRGAEIVVCT 434


>AL034488-3|CAA22456.1|  504|Caenorhabditis elegans Hypothetical
           protein Y54G11A.3 protein.
          Length = 504

 Score = 91.1 bits (216), Expect = 7e-19
 Identities = 46/93 (49%), Positives = 61/93 (65%), Gaps = 3/93 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D    G  +L   TY+VLDEADRMLDMGFE  IR+I+ +IRPDR   + SATWP+ 
Sbjct: 221 GRLTDLSNDGVISLASVTYVVLDEADRMLDMGFEVAIRRILFEIRPDRLVALTSATWPEG 280

Query: 437 VKKLAEDYLGDYIQINIGSLQLS---AITTFFK 526
           V+KL + Y  + +    GSL L+   ++T FF+
Sbjct: 281 VRKLTDKYTKEAVMAVNGSLDLTSCKSVTQFFE 313



 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 41/90 (45%), Positives = 56/90 (62%), Gaps = 6/90 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ-PPIRRGD-----GPIALVLAPTRELAQQIQQVAADFGHTS 164
           GSGKTLA++LPA++HI+ Q     + D      P  LVL+PTRELAQQI+     + +  
Sbjct: 131 GSGKTLAFLLPALLHIDAQLAQYEKNDEEQKPSPFVLVLSPTRELAQQIEGEVKKYSYNG 190

Query: 165 YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           Y ++ C++GG  + EQ      GVEIVIAT
Sbjct: 191 Y-KSVCLYGGGSRPEQVEACRGGVEIVIAT 219


>AC024859-14|AAY43989.1|  643|Caenorhabditis elegans Hypothetical
           protein Y71H2AM.19 protein.
          Length = 643

 Score = 90.6 bits (215), Expect = 9e-19
 Identities = 44/83 (53%), Positives = 63/83 (75%), Gaps = 5/83 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE----QIRPDRQTLMWSAT 424
           GRLID +++G   ++ C YLVLDEADRMLDMGFEPQIR+I+E      + +R T M+SAT
Sbjct: 310 GRLIDVMDQGLIGMEGCRYLVLDEADRMLDMGFEPQIRQIVECNRMPSKEERITAMFSAT 369

Query: 425 WPKEVKKLAEDYLGD-YIQINIG 490
           +PKE++ LA+D+L + Y+ + +G
Sbjct: 370 FPKEIQLLAQDFLKENYVFLAVG 392



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 32/96 (33%), Positives = 49/96 (51%), Gaps = 12/96 (12%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI-----------RRGDGPIALVLAPTRELAQQIQQVAAD 149
           GSGKT A+++P +  I    P            R+   P ALVL+PTREL+ QI   +  
Sbjct: 213 GSGKTAAFLVPLVNAILQDGPDAVHRSVTSSGGRKKQYPSALVLSPTRELSLQIFNESRK 272

Query: 150 FGHTSYVRNTCVFGGAPK-REQARDLERGVEIVIAT 254
           F + + + +  ++GG    ++Q   L  G  I+IAT
Sbjct: 273 FAYRTPITSALLYGGRENYKDQIHKLRLGCHILIAT 308



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 18/45 (40%), Positives = 26/45 (57%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           + NI+Q +   +E EK + L  LL   G S    + T++FVETKR
Sbjct: 398 SENIMQKIVWVEEDEKRSYLMDLLDATGDS----SLTLVFVETKR 438


>AC006665-5|AAF39907.1|  630|Caenorhabditis elegans Hypothetical
           protein H27M09.1 protein.
          Length = 630

 Score = 82.6 bits (195), Expect = 2e-16
 Identities = 41/91 (45%), Positives = 58/91 (63%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D L K   NL+ C YLVLDEADRMLDMGFE +I+ I    +  RQTL++SAT P++
Sbjct: 331 GRLSDMLTKKIINLEVCRYLVLDEADRMLDMGFEDEIKSIFYFFKAQRQTLLFSATMPRK 390

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITTFFKL 529
           ++  A+  L   I +N+G    +++    +L
Sbjct: 391 IQFFAKSALVKPIVVNVGRAGAASLNVLQEL 421



 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 34/93 (36%), Positives = 51/93 (54%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAAD----FGHT 161
           GSGKT+ ++LP ++    Q    P  R +GP  L++ P+RELA+QI  +  +     G  
Sbjct: 237 GSGKTMTFVLPLVMFCLEQEMKLPFMRSEGPFGLIIVPSRELARQIFDLIIEMFDALGKA 296

Query: 162 SY--VRNTCVFGGAPKREQARDLERGVEIVIAT 254
               +R     GG P  EQA+D+  G+ IV+AT
Sbjct: 297 GLPEMRAGLCIGGVPIGEQAKDVRDGIHIVVAT 329


>U13070-1|AAK67224.1|  730|Caenorhabditis elegans Hypothetical
           protein F01F1.7 protein.
          Length = 730

 Score = 80.2 bits (189), Expect = 1e-15
 Identities = 40/88 (45%), Positives = 56/88 (63%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +V I + P + R +    GP A+++APTRELAQQI++    FG    +
Sbjct: 348 GSGKTAAFLLPLLVWITSLPKMERQEHRDLGPYAIIMAPTRELAQQIEEETNKFGKLLGI 407

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           +   V GGA + +Q   L  GVE+VIAT
Sbjct: 408 KTVSVIGGASREDQGMKLRMGVEVVIAT 435



 Score = 64.1 bits (149), Expect = 9e-11
 Identities = 41/105 (39%), Positives = 58/105 (55%), Gaps = 26/105 (24%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD------------- 397
           GRL+D LE     L +CTY++LDEADRMLDMGFEP ++K++E + PD             
Sbjct: 437 GRLLDVLENRYLLLNQCTYVILDEADRMLDMGFEPDVQKVLEYM-PDTNMKKDTDEFDNE 495

Query: 398 -------------RQTLMWSATWPKEVKKLAEDYLGDYIQINIGS 493
                        RQT+M++AT    +++LA  YL     ++IGS
Sbjct: 496 EALMKGFSTREKYRQTVMFTATMSSAIERLARQYLRRPAVVHIGS 540


>AF079509-1|AAC28388.1|  720|Caenorhabditis elegans germline RNA
           helicase-3 protein.
          Length = 720

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 40/86 (46%), Positives = 51/86 (59%), Gaps = 6/86 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIE----QIRPDRQTLMWSA 421
           GR+  F E G   L +C YLVLDEADRM+D MGF P+I +II          RQT+M+SA
Sbjct: 434 GRVKHFCEDGAIKLDKCRYLVLDEADRMIDSMGFGPEIEQIINYKNMPKNDKRQTMMFSA 493

Query: 422 TWPKEVKKLAEDYL-GDYIQINIGSL 496
           T+P  V++ A   L  DY  I I  +
Sbjct: 494 TFPSSVQEAARKLLREDYTMITIDKI 519



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRG-DG---PIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +  +  +  +  G +G   P  ++L PTRELA QI      F + S +
Sbjct: 345 GSGKTAAFLLPIMSRLILEKDLNYGAEGGCYPRCIILTPTRELADQIYNEGRKFSYQSVM 404

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
               V+GG         + +G  I++ T
Sbjct: 405 EIKPVYGGINVGYNKSQIMKGCTIIVGT 432


>AF003145-4|AAB57719.1|  720|Caenorhabditis elegans Germ-line
           helicase protein 3 protein.
          Length = 720

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 40/86 (46%), Positives = 51/86 (59%), Gaps = 6/86 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIE----QIRPDRQTLMWSA 421
           GR+  F E G   L +C YLVLDEADRM+D MGF P+I +II          RQT+M+SA
Sbjct: 434 GRVKHFCEDGAIKLDKCRYLVLDEADRMIDSMGFGPEIEQIINYKNMPKNDKRQTMMFSA 493

Query: 422 TWPKEVKKLAEDYL-GDYIQINIGSL 496
           T+P  V++ A   L  DY  I I  +
Sbjct: 494 TFPSSVQEAARKLLREDYTMITIDKI 519



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRG-DG---PIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +  +  +  +  G +G   P  ++L PTRELA QI      F + S +
Sbjct: 345 GSGKTAAFLLPIMSRLILEKDLNYGAEGGCYPRCIILTPTRELADQIYNEGRKFSYQSVM 404

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
               V+GG         + +G  I++ T
Sbjct: 405 EIKPVYGGINVGYNKSQIMKGCTIIVGT 432


>U62772-1|AAB04136.1|  763|Caenorhabditis elegans RNA helicase
           protein.
          Length = 763

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 37/86 (43%), Positives = 53/86 (61%), Gaps = 6/86 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIE----QIRPDRQTLMWSA 421
           GR+  F E+GT  L +C + VLDEADRM+D MGF   I  I+       + +RQTLM+SA
Sbjct: 477 GRIKHFCEEGTIKLDKCRFFVLDEADRMIDAMGFGTDIETIVNYDSMPRKENRQTLMFSA 536

Query: 422 TWPKEVKKLAEDYLGD-YIQINIGSL 496
           T+P  V++ A  +L + Y+ I I  +
Sbjct: 537 TFPDSVQEAARAFLRENYVMIAIDKI 562



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR-GDG---PIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +  + +   +   G+G   P  ++L PTRELA QI      F + + +
Sbjct: 388 GSGKTAAFLLPIMTRLIDDNNLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFAYQTMM 447

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
               V+GG         +E+G  I++ T
Sbjct: 448 EIKPVYGGLAVGYNKGQIEKGATIIVGT 475


>U60449-1|AAB03510.1|  974|Caenorhabditis elegans GLH-2 protein.
          Length = 974

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 6/86 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKII--EQI--RPDRQTLMWSA 421
           GR+  F E+GT  L +C + VLDEADRM+D MGF   I  I+  E +  + +RQTLM+SA
Sbjct: 688 GRIKHFCEEGTIKLDKCRFFVLDEADRMIDAMGFGTDIDTIVNYESMPKKENRQTLMFSA 747

Query: 422 TWPKEVKKLAEDYLGD-YIQINIGSL 496
           T+P  V++ A ++L + YI + I  +
Sbjct: 748 TFPDSVQEAARNHLKEGYIMLAIDKI 773



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR-GDG---PIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +  + ++  +   G+G   P  ++L PTREL  QI      F + + +
Sbjct: 599 GSGKTAAFLLPIMARLIDENDLNTAGEGGCYPRCIILTPTRELTDQIYNEGRKFAYQTMM 658

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
               V+GG         +E+G  I++ T
Sbjct: 659 EIRPVYGGLAVGYNKGQIEKGATIIVGT 686


>U60194-1|AAB03337.1|  974|Caenorhabditis elegans RNA helicase GLH-2
           protein.
          Length = 974

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 6/86 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKII--EQI--RPDRQTLMWSA 421
           GR+  F E+GT  L +C + VLDEADRM+D MGF   I  I+  E +  + +RQTLM+SA
Sbjct: 688 GRIKHFCEEGTIKLDKCRFFVLDEADRMIDAMGFGTDIDTIVNYESMPKKENRQTLMFSA 747

Query: 422 TWPKEVKKLAEDYLGD-YIQINIGSL 496
           T+P  V++ A ++L + YI + I  +
Sbjct: 748 TFPDSVQEAARNHLKEGYIMLAIDKI 773



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR-GDG---PIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +  + ++  +   G+G   P  ++L PTREL  QI      F + + +
Sbjct: 599 GSGKTAAFLLPIMARLIDENDLNTAGEGGCYPRCIILTPTRELTDQIYNEGRKFAYQTMM 658

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
               V+GG         +E+G  I++ T
Sbjct: 659 EIRPVYGGLAVGYNKGQIEKGATIIVGT 686


>L19948-1|AAC27384.1|  763|Caenorhabditis elegans RNA helicase
           protein.
          Length = 763

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 37/86 (43%), Positives = 53/86 (61%), Gaps = 6/86 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIE----QIRPDRQTLMWSA 421
           GR+  F E+GT  L +C + VLDEADRM+D MGF   I  I+       + +RQTLM+SA
Sbjct: 477 GRIKHFCEEGTIKLDKCRFFVLDEADRMIDAMGFGTDIETIVNYDSMPRKENRQTLMFSA 536

Query: 422 TWPKEVKKLAEDYLGD-YIQINIGSL 496
           T+P  V++ A  +L + Y+ I I  +
Sbjct: 537 TFPDSVQEAARAFLRENYVMIAIDKI 562



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR-GDG---PIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +  + +   +   G+G   P  ++L PTRELA QI      F + + +
Sbjct: 388 GSGKTAAFLLPIMTRLIDDNNLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFAYQTMM 447

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
               V+GG         +E+G  I++ T
Sbjct: 448 EIKPVYGGLAVGYNKGQIEKGATIIVGT 475


>AF000197-1|AAB52901.2|  763|Caenorhabditis elegans Germ-line
           helicase protein 1 protein.
          Length = 763

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 37/86 (43%), Positives = 53/86 (61%), Gaps = 6/86 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIE----QIRPDRQTLMWSA 421
           GR+  F E+GT  L +C + VLDEADRM+D MGF   I  I+       + +RQTLM+SA
Sbjct: 477 GRIKHFCEEGTIKLDKCRFFVLDEADRMIDAMGFGTDIETIVNYDSMPRKENRQTLMFSA 536

Query: 422 TWPKEVKKLAEDYLGD-YIQINIGSL 496
           T+P  V++ A  +L + Y+ I I  +
Sbjct: 537 TFPDSVQEAARAFLRENYVMIAIDKI 562



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR-GDG---PIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +  + +   +   G+G   P  ++L PTRELA QI      F + + +
Sbjct: 388 GSGKTAAFLLPIMTRLIDDNNLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFAYQTMM 447

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
               V+GG         +E+G  I++ T
Sbjct: 448 EIKPVYGGLAVGYNKGQIEKGATIIVGT 475


>AC006625-11|AAK68269.1|  974|Caenorhabditis elegans Germ-line
           helicase protein 2 protein.
          Length = 974

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 6/86 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKII--EQI--RPDRQTLMWSA 421
           GR+  F E+GT  L +C + VLDEADRM+D MGF   I  I+  E +  + +RQTLM+SA
Sbjct: 688 GRIKHFCEEGTIKLDKCRFFVLDEADRMIDAMGFGTDIDTIVNYESMPKKENRQTLMFSA 747

Query: 422 TWPKEVKKLAEDYLGD-YIQINIGSL 496
           T+P  V++ A ++L + YI + I  +
Sbjct: 748 TFPDSVQEAARNHLKEGYIMLAIDKI 773



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR-GDG---PIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +  + ++  +   G+G   P  ++L PTREL  QI      F + + +
Sbjct: 599 GSGKTAAFLLPIMARLIDENDLNTAGEGGCYPRCIILTPTRELTDQIYNEGRKFAYQTMM 658

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
               V+GG         +E+G  I++ T
Sbjct: 659 EIRPVYGGLAVGYNKGQIEKGATIIVGT 686


>AC006605-1|AAK85443.1|  430|Caenorhabditis elegans Conserved
           germline helicase protein1 protein.
          Length = 430

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 29/90 (32%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D +EKG   ++ C  LVLDEAD++L   F+  + ++I  +  +RQ +++SAT+P  
Sbjct: 170 GRILDLMEKGVAKMEHCKTLVLDEADKLLSQDFQGILDRLINFLPKERQVMLYSATFPNT 229

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           V    + ++    +IN+   L L  +T ++
Sbjct: 230 VTSFMQKHMHKPYEINLMEELTLLGVTQYY 259



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 30/84 (35%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY +P I  I  QP ++      A+V+ PTRELA Q  Q+  +      ++   
Sbjct: 90  GTGKTGAYCIPVIEKI--QPALKAIQ---AMVIVPTRELALQTSQICVELSKHIQLKVMV 144

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   R+    L   V +VIAT
Sbjct: 145 TTGGTDLRDDIMRLNGTVHLVIAT 168


>Z29115-1|CAA82362.1|  489|Caenorhabditis elegans Hypothetical
           protein T26G10.1 protein.
          Length = 489

 Score = 64.5 bits (150), Expect = 7e-11
 Identities = 35/81 (43%), Positives = 55/81 (67%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRL+D LE  KG  NL+   +L++DEADR+L+M FE ++ KI++ I  +R+T ++SAT  
Sbjct: 171 GRLVDHLENTKGF-NLKALKFLIMDEADRILNMDFEVELDKILKVIPRERRTYLFSATMT 229

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           K+V KL    L D  ++++ S
Sbjct: 230 KKVSKLERASLRDPARVSVSS 250



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 30/84 (35%), Positives = 39/84 (46%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ +P +  + + P          LVL PTRELA QI Q     G    +    
Sbjct: 91  GSGKTGAFAIPVLQSLLDHP-----QAFFCLVLTPTRELAFQIGQQFEALGSGIGLIAAV 145

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     QA  L R   I++AT
Sbjct: 146 IVGGVDMAAQAMALARRPHIIVAT 169


>AC024753-1|AAF60456.1|  732|Caenorhabditis elegans Hypothetical
           protein Y23H5B.6 protein.
          Length = 732

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query: 248 CYSGRLIDFL-EKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  + E    +      LVLDEADRMLDMGF  Q+  II  +  +RQTL++SAT
Sbjct: 203 CTPGRLLQHMDENAQMSCDSLQVLVLDEADRMLDMGFSKQLNSIINNLPAERQTLLFSAT 262

Query: 425 WPKEVKKLAEDYLGDYIQINI 487
             + VK L      D + +++
Sbjct: 263 QTRNVKDLCRVCTNDPVFVSV 283



 Score = 32.3 bits (70), Expect = 0.33
 Identities = 26/84 (30%), Positives = 40/84 (47%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA ++P ++    +       G  AL+++PTRELA Q        G         
Sbjct: 123 GSGKTLALVIP-VLEALWRAKWSPDYGLGALIISPTRELALQTFSTINAVGAHHGFSCGL 181

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG+    + R+   G+ I++ T
Sbjct: 182 VIGGSDVAFE-RNRISGINIIVCT 204


>U13876-12|AAA21169.1|  363|Caenorhabditis elegans Hypothetical
           protein F57B9.3 protein.
          Length = 363

 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 35/101 (34%), Positives = 50/101 (49%), Gaps = 2/101 (1%)
 Frame = +2

Query: 227 EGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQT 406
           E  + SH   G   DFL    ++  R    VLDEAD ML  GF+ QI ++   +  D Q 
Sbjct: 105 ENDKISHVLMGTPKDFLSNIPSDTSRIKMFVLDEADEMLSKGFKDQIYEVFRSMPQDVQV 164

Query: 407 LMWSATWPKEVKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           ++ SAT P EV  +   ++ D I+I +    L L  I  F+
Sbjct: 165 VLLSATMPSEVLDVTNRFMRDPIRILVKKDELTLEGIRQFY 205


>AF039720-12|AAB96704.1|  399|Caenorhabditis elegans Hypothetical
           protein F33D11.10 protein.
          Length = 399

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +     +    LVLDEAD ML+ GF+ Q+  I   + P  Q ++ SAT P E
Sbjct: 153 GRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHE 212

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ D I+I +    L L  I  FF
Sbjct: 213 ILEMTSKFMTDPIRILVKRDELTLEGIKQFF 243



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 29/84 (34%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  ++ Q  +R      AL+L+PTRELA QIQ+V    G    V+   
Sbjct: 73  GTGKTATFSISVLQSLDTQ--VRETQ---ALILSPTRELAVQIQKVVLALGDYMNVQCHA 127

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG    E  R L+ G  +V  T
Sbjct: 128 CIGGTNLGEDIRKLDYGQHVVSGT 151


>AC024844-2|AAK29954.2|  399|Caenorhabditis elegans Hypothetical
           protein Y65B4A.6 protein.
          Length = 399

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +     +    LVLDEAD ML+ GF+ Q+  I   + P  Q ++ SAT P E
Sbjct: 153 GRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHE 212

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ D I+I +    L L  I  FF
Sbjct: 213 ILEMTSKFMTDPIRILVKRDELTLEGIKQFF 243



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 29/84 (34%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  ++ Q  +R      AL+L+PTRELA QIQ+V    G    V+   
Sbjct: 73  GTGKTATFSISVLQSLDTQ--VRETQ---ALILSPTRELAVQIQKVVLALGDYMNVQCHA 127

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG    E  R L+ G  +V  T
Sbjct: 128 CIGGTNLGEDIRKLDYGQHVVSGT 151


>AC024876-4|AAU05555.1|  825|Caenorhabditis elegans Hypothetical
           protein Y94H6A.5a protein.
          Length = 825

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 28/77 (36%), Positives = 47/77 (61%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+  + +    L    Y+V DEADR+ +MGF+ Q+ + +++I   RQTL++SAT PK 
Sbjct: 152 GRLLHVIVEMDLRLSYVQYVVFDEADRLFEMGFQDQLTETLKRIPESRQTLLFSATLPKM 211

Query: 437 VKKLAEDYLGDYIQINI 487
           +   A+  L D + + +
Sbjct: 212 LVDFAKAGLTDPMLVRL 228



 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 29/84 (34%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+++P +  +      R   G  AL+++PTRELA Q  +V  + G  + +R  C
Sbjct: 71  GSGKTAAFVIPMLQKLKR----RDTTGIRALMVSPTRELALQTFKVVKELGRFTGLRCAC 126

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    EQ   +    +I++AT
Sbjct: 127 LVGGDQIEEQFSTIHENPDILLAT 150


>AC024876-3|AAU05556.1|  871|Caenorhabditis elegans Hypothetical
           protein Y94H6A.5b protein.
          Length = 871

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 28/77 (36%), Positives = 47/77 (61%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+  + +    L    Y+V DEADR+ +MGF+ Q+ + +++I   RQTL++SAT PK 
Sbjct: 152 GRLLHVIVEMDLRLSYVQYVVFDEADRLFEMGFQDQLTETLKRIPESRQTLLFSATLPKM 211

Query: 437 VKKLAEDYLGDYIQINI 487
           +   A+  L D + + +
Sbjct: 212 LVDFAKAGLTDPMLVRL 228



 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 29/84 (34%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+++P +  +      R   G  AL+++PTRELA Q  +V  + G  + +R  C
Sbjct: 71  GSGKTAAFVIPMLQKLKR----RDTTGIRALMVSPTRELALQTFKVVKELGRFTGLRCAC 126

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    EQ   +    +I++AT
Sbjct: 127 LVGGDQIEEQFSTIHENPDILLAT 150


>Z12116-1|CAA78102.1|  402|Caenorhabditis elegans protein (
           C.elegans mRNA for eIF-4A homologue. ).
          Length = 402

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 32/84 (38%), Positives = 47/84 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+++ P  +     ALV+APTRELAQQIQ+V +  G    V    
Sbjct: 76  GTGKTATFSVSILQRIDHEDPHVQ-----ALVMAPTRELAQQIQKVMSALGEYLNVNILP 130

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   R+  R LE G+ +V+ T
Sbjct: 131 CIGGTSVRDDQRKLEAGIHVVVGT 154



 Score = 54.0 bits (124), Expect = 9e-08
 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +   +  R    VLDEAD ML  GF+ QI ++   +  D Q ++ SAT P E
Sbjct: 156 GRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSE 215

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V  +   ++ + I+I +    L L  I  F+
Sbjct: 216 VLDVTNRFMRNPIRILVKKDELTLEGIRQFY 246


>U13876-3|AAA21170.1|  402|Caenorhabditis elegans Initiation factor
           protein 1, isoforma protein.
          Length = 402

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 32/84 (38%), Positives = 47/84 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+++ P  +     ALV+APTRELAQQIQ+V +  G    V    
Sbjct: 76  GTGKTATFSVSILQRIDHEDPHVQ-----ALVMAPTRELAQQIQKVMSALGEYLNVNILP 130

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   R+  R LE G+ +V+ T
Sbjct: 131 CIGGTSVRDDQRKLEAGIHVVVGT 154



 Score = 54.0 bits (124), Expect = 9e-08
 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +   +  R    VLDEAD ML  GF+ QI ++   +  D Q ++ SAT P E
Sbjct: 156 GRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSE 215

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V  +   ++ + I+I +    L L  I  F+
Sbjct: 216 VLDVTNRFMRNPIRILVKKDELTLEGIRQFY 246


>EU051652-1|ABS85191.1|  973|Caenorhabditis elegans MEL-46 protein.
          Length = 973

 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+   ++ G  N+    + VLDEAD+++D  F   I  II  +   RQ  ++SAT+P+ 
Sbjct: 149 GRIAQLVKLGAMNMSHVDFFVLDEADKLMDEVFRDDINIIINSLPQIRQVAVFSATYPRN 208

Query: 437 VKKLAEDYLGD--YIQINIGSLQLSAITTF 520
           +  L   +L D   ++ N   +QL  I  +
Sbjct: 209 LDNLLSTFLRDAALVRFNADDVQLFGIKQY 238



 Score = 31.1 bits (67), Expect = 0.76
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKTL + + A+ ++++     R      +++ PTRE++ QI++       T   R + 
Sbjct: 69  GTGKTLVFSVLAVENLDS-----RSSHIQKVIVTPTREISVQIKETVRKVAPTG-ARTSV 122

Query: 183 VFGGAPKREQARDLER-GVEIVIAT 254
             GG+  +    DL++   +IVI T
Sbjct: 123 YVGGSAHKLNLIDLKQTRPQIVIGT 147


>CU457744-1|CAM36366.2|  973|Caenorhabditis elegans Hypothetical
           protein T06A10.1 protein.
          Length = 973

 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+   ++ G  N+    + VLDEAD+++D  F   I  II  +   RQ  ++SAT+P+ 
Sbjct: 149 GRIAQLVKLGAMNMSHVDFFVLDEADKLMDEVFRDDINIIINSLPQIRQVAVFSATYPRN 208

Query: 437 VKKLAEDYLGD--YIQINIGSLQLSAITTF 520
           +  L   +L D   ++ N   +QL  I  +
Sbjct: 209 LDNLLSTFLRDAALVRFNADDVQLFGIKQY 238



 Score = 31.1 bits (67), Expect = 0.76
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKTL + + A+ ++++     R      +++ PTRE++ QI++       T   R + 
Sbjct: 69  GTGKTLVFSVLAVENLDS-----RSSHIQKVIVTPTREISVQIKETVRKVAPTG-ARTSV 122

Query: 183 VFGGAPKREQARDLER-GVEIVIAT 254
             GG+  +    DL++   +IVI T
Sbjct: 123 YVGGSAHKLNLIDLKQTRPQIVIGT 147


>AF067608-1|AAC17654.2|  544|Caenorhabditis elegans Hypothetical
           protein B0511.6 protein.
          Length = 544

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 29/84 (34%), Positives = 51/84 (60%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LPAI  + ++   ++ +G   ++++PTREL+ Q   V ++    S +    
Sbjct: 115 GSGKTLAFLLPAI-ELLHKLNWKQHNGTGVIIVSPTRELSMQTYGVLSELLEGSNLTYGL 173

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG+ +  +   L +GV I++AT
Sbjct: 174 VMGGSNRSAEKDKLAKGVSILVAT 197



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL+D L+     L R    L++DEADR+LD+GFE ++++++  +   RQ++++SAT   
Sbjct: 199 GRLLDHLQNTDNFLVRNMKCLIIDEADRILDIGFEIEMQQVLRHLPKQRQSMLFSATHSP 258

Query: 434 EVKKLAE 454
           +V +L +
Sbjct: 259 KVDELVK 265


>Z54327-6|CAA91120.1|  425|Caenorhabditis elegans Hypothetical
           protein C26D10.2a protein.
          Length = 425

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 22/78 (28%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRML-DMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++     G   L +  Y VLDE D+M+ D      +++I++     +Q +M+SAT PK
Sbjct: 170 GRMLALARSGKLKLDKVKYFVLDECDKMIGDADMRRDVQEIVKMTPQQKQVMMFSATLPK 229

Query: 434 EVKKLAEDYLGDYIQINI 487
           E++ + + ++ D +++ +
Sbjct: 230 ELRTVCKRFMQDPMEVYV 247


>Z81094-7|CAB03153.2|  960|Caenorhabditis elegans Hypothetical
           protein F58G11.2 protein.
          Length = 960

 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 5/88 (5%)
 Frame = +3

Query: 6   SGKTLAYILPAIVHI-----NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           +GKT A+ LP I  I       +   R+ DGP+AL+LAPTRELA QI +    +   + +
Sbjct: 429 AGKTAAFGLPIIDKILRMDEETRNKARQDDGPLALILAPTRELAAQIHEALRTYCQNTDI 488

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
                +G + +     ++  G +I+I T
Sbjct: 489 IVLLSYGQSDRARSLNEIRNGCDILIGT 516



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 8/77 (10%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRML-DMGFEP--QIRKIIE-----QIRPDRQTLM 412
           GR++DF  K   +L    +LV DEADR+L DM  +P   +  II+     +    RQT+M
Sbjct: 518 GRIMDFTVKSHISLLHLRFLVFDEADRLLQDMKKDPLGHLGAIIKDAGFMESAATRQTIM 577

Query: 413 WSATWPKEVKKLAEDYL 463
            SAT+   V  +A + +
Sbjct: 578 TSATFNASVMTVANELM 594


>Z54327-7|CAD57690.1|  268|Caenorhabditis elegans Hypothetical
           protein C26D10.2b protein.
          Length = 268

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRML-DMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++     G   L +  Y VLDE D+M+ D      +++I++     +Q +M+SAT PK
Sbjct: 170 GRMLALARSGKLKLDKVKYFVLDECDKMIGDADMRRDVQEIVKMTPQQKQVMMFSATLPK 229

Query: 434 EVKKLAEDYLGD 469
           E++ + + ++ D
Sbjct: 230 ELRTVCKRFMQD 241


>AC006661-5|AAF39890.2|  488|Caenorhabditis elegans Hypothetical
           protein H20J04.4a protein.
          Length = 488

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 30/84 (35%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKTLA+ +P +  ++  P      G  AL+L PTRELA QI +     G    ++ + 
Sbjct: 136 GTGKTLAFAIPILQKLSVDPY-----GIYALILTPTRELAFQIAEQFTALGKPITLKCSV 190

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     QAR+L     +V+AT
Sbjct: 191 IVGGRSLIHQARELSERPHVVVAT 214



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 4/68 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNL----QRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           GRL D +E     +    ++  + VLDEADRML+  +  Q++ I E I   RQTL+ SAT
Sbjct: 216 GRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSAT 275

Query: 425 WPKEVKKL 448
               +  L
Sbjct: 276 ITNNINML 283


>AC006661-4|ABB88208.1|  561|Caenorhabditis elegans Hypothetical
           protein H20J04.4b protein.
          Length = 561

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 30/84 (35%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKTLA+ +P +  ++  P      G  AL+L PTRELA QI +     G    ++ + 
Sbjct: 136 GTGKTLAFAIPILQKLSVDPY-----GIYALILTPTRELAFQIAEQFTALGKPITLKCSV 190

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     QAR+L     +V+AT
Sbjct: 191 IVGGRSLIHQARELSERPHVVVAT 214



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 4/68 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNL----QRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           GRL D +E     +    ++  + VLDEADRML+  +  Q++ I E I   RQTL+ SAT
Sbjct: 216 GRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSAT 275

Query: 425 WPKEVKKL 448
               +  L
Sbjct: 276 ITNNINML 283


>AC025726-23|AAK73934.1|  763|Caenorhabditis elegans Hypothetical
           protein Y71G12B.8 protein.
          Length = 763

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 26/58 (44%), Positives = 38/58 (65%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI 487
           LVLDEADRML+  F  Q+ ++I     +RQTL++SAT  +E+ +LA   L   ++I I
Sbjct: 322 LVLDEADRMLEEAFRDQMNELIRLCAQNRQTLLFSATMTEEIDELASMSLQKPVKIFI 379



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 28/84 (33%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A++LP +  +  +P  +       LVL PTRELA Q+ QV         +    
Sbjct: 195 GTGKTAAFVLPILERMIYRP--KGASCTRVLVLVPTRELAIQVFQVFRKLSTFIQLEVCL 252

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L  G ++V+AT
Sbjct: 253 CAGGLDLKAQEAALRSGPDVVVAT 276


>AF079508-1|AAC28387.1| 1156|Caenorhabditis elegans germline RNA
            helicase-4 protein.
          Length = 1156

 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = +2

Query: 257  GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG-FEPQIRKII-EQIRPDRQTLMWSATWP 430
            GRL DF+  G  +L +  Y+VLDEADRM+D   F  ++ KII       +QT+++SA++ 
Sbjct: 875  GRLQDFVNAGEVSLSKMKYIVLDEADRMVDSNDFGEEVSKIIGSPGERTQQTVLFSASFS 934

Query: 431  KEVKKLAEDYLGDYIQINIGSLQLSAITT 517
            ++   L  D L  +++     LQ+    T
Sbjct: 935  ED---LQSDDLPKFVKEGYTMLQVDKFGT 960



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 7/91 (7%)
 Frame = +3

Query: 3    GSGKTLAYILPAIVHINNQPPIRRG-----DGPIALVLAPTRELAQQIQQVAADFGHTSY 167
            GSGKTLA+++P ++ +  +    R        P  L++APTREL  Q    A    + + 
Sbjct: 783  GSGKTLAFLIPFVIKLMEEFEKDRDVTDEKPSPRLLIVAPTRELVNQTFTTARQLTYETG 842

Query: 168  VRNTCVFGGAPKREQARDLE--RGVEIVIAT 254
            ++    FGG  +    + L     + I++AT
Sbjct: 843  LKCGLAFGGYSRNANVQHLRSFSQLNILVAT 873


>AF039718-2|AAB96745.2| 1156|Caenorhabditis elegans Germ-line helicase
            protein 4 protein.
          Length = 1156

 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = +2

Query: 257  GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG-FEPQIRKII-EQIRPDRQTLMWSATWP 430
            GRL DF+  G  +L +  Y+VLDEADRM+D   F  ++ KII       +QT+++SA++ 
Sbjct: 875  GRLQDFVNAGEVSLSKMKYIVLDEADRMVDSNDFGEEVSKIIGSPGERTQQTVLFSASFS 934

Query: 431  KEVKKLAEDYLGDYIQINIGSLQLSAITT 517
            ++   L  D L  +++     LQ+    T
Sbjct: 935  ED---LQSDDLPKFVKEGYTMLQVDKFGT 960



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 7/91 (7%)
 Frame = +3

Query: 3    GSGKTLAYILPAIVHINNQPPIRRG-----DGPIALVLAPTRELAQQIQQVAADFGHTSY 167
            GSGKTLA+++P ++ +  +    R        P  L++APTREL  Q    A    + + 
Sbjct: 783  GSGKTLAFLIPFVIKLMEEFEKDRDVTDEKPSPRLLIVAPTRELVNQTFTTARQLTYETG 842

Query: 168  VRNTCVFGGAPKREQARDLE--RGVEIVIAT 254
            ++    FGG  +    + L     + I++AT
Sbjct: 843  LKCGLAFGGYSRNANVQHLRSFSQLNILVAT 873


>U08102-1|AAB65852.1|  417|Caenorhabditis elegans putative RNA
           helicase protein.
          Length = 417

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/77 (28%), Positives = 46/77 (59%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++     G   L +  Y VLDE D+M+    +  +R+ +++I   +Q +M+SAT PKE
Sbjct: 169 GRMLALARSGKLKLDKVKYFVLDECDKMIG---DADMRRDVQEI---KQVMMFSATLPKE 222

Query: 437 VKKLAEDYLGDYIQINI 487
           ++ + + ++ D +++ +
Sbjct: 223 LRTVCKRFMQDPMEVYV 239


>U80447-2|AAO38637.1|  579|Caenorhabditis elegans Hypothetical
           protein F55F8.2b protein.
          Length = 579

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 7/91 (7%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI------NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTS 164
           GSGKTLA+ +P +  +      + +       GP AL++APTREL  QI +       T+
Sbjct: 36  GSGKTLAFGIPLVARLLESSDDSQETESTEVRGPRALIVAPTRELVIQIMKHINALISTT 95

Query: 165 YVRNTCVFGGAPKREQARDL-ERGVEIVIAT 254
            +  T + GG  + +Q R + ++  +IV+AT
Sbjct: 96  QLIATSIVGGLAQVKQERIISQQRPDIVVAT 126



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 5/42 (11%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDR-----QTLMWSAT 424
           LV+DE DRM++ G+  ++  I+ +I  +      QTL++SAT
Sbjct: 152 LVVDETDRMVEEGYFAELTHILNKIHEESEKEKLQTLVFSAT 193


>U80447-1|AAB37806.1|  746|Caenorhabditis elegans Hypothetical
           protein F55F8.2a protein.
          Length = 746

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 7/91 (7%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI------NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTS 164
           GSGKTLA+ +P +  +      + +       GP AL++APTREL  QI +       T+
Sbjct: 203 GSGKTLAFGIPLVARLLESSDDSQETESTEVRGPRALIVAPTRELVIQIMKHINALISTT 262

Query: 165 YVRNTCVFGGAPKREQARDL-ERGVEIVIAT 254
            +  T + GG  + +Q R + ++  +IV+AT
Sbjct: 263 QLIATSIVGGLAQVKQERIISQQRPDIVVAT 293



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 5/42 (11%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDR-----QTLMWSAT 424
           LV+DE DRM++ G+  ++  I+ +I  +      QTL++SAT
Sbjct: 319 LVVDETDRMVEEGYFAELTHILNKIHEESEKEKLQTLVFSAT 360


>Z22177-1|CAA80151.1|  578|Caenorhabditis elegans Hypothetical
           protein ZK512.2 protein.
          Length = 578

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 30/85 (35%), Positives = 43/85 (50%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LP +  I N        G  AL+L+P+REL  QI  V   F     +    
Sbjct: 56  GSGKTLAFVLPMMRMIQNAKLQPADIG--ALILSPSRELCSQIVSVIQPFAEKLNLTVET 113

Query: 183 VFGGAPKREQARDLE-RGVEIVIAT 254
           V GG    +  +  + + V I++AT
Sbjct: 114 VTGGQKVDKNIKMFKNKNVNILVAT 138



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 4/94 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQR----CTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           GRL   ++   T + R       LV+DEADR  ++ FE  +R+I+  I   R+T ++SAT
Sbjct: 140 GRLFQIIQHEKTLIARKMRTLQLLVIDEADRFNEIQFEDHMREILSCIPKQRRTGLFSAT 199

Query: 425 WPKEVKKLAEDYLGDYIQINIGSLQLSAITTFFK 526
             KE   L    L +  Q+ +   + SA  +  K
Sbjct: 200 QVKEEDDLMVFGLRNAKQVKVAQERNSAAPSTLK 233


>AF025451-4|AAL16306.1|  567|Caenorhabditis elegans Hypothetical
           protein C24H12.4b protein.
          Length = 567

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +2

Query: 308 TYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYL-GDYIQIN 484
           +YLV+DEAD +L  G+E ++ KI  ++ P  Q LM SAT   ++  L + ++ G  I I 
Sbjct: 172 SYLVMDEADLLLSFGYEEEMIKIRSKLPPTYQCLMTSATLKDDMTTLKKLFMTGPVITIK 231

Query: 485 I--GSLQLSAITTFFKL 529
           +  G L  S   T ++L
Sbjct: 232 LTEGDLPNSDQLTQYQL 248



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 3/39 (7%)
 Frame = +3

Query: 33  PAIVHINNQPPIRRGDG---PIALVLAPTRELAQQIQQV 140
           P +  ++ +P  +  DG   P A+++APT+EL  QI ++
Sbjct: 77  PQVDEMDFEPEHKTNDGSVGPSAVIIAPTKELITQIYKL 115


>AF025451-3|AAB71200.2|  634|Caenorhabditis elegans Hypothetical
           protein C24H12.4a protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +2

Query: 308 TYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYL-GDYIQIN 484
           +YLV+DEAD +L  G+E ++ KI  ++ P  Q LM SAT   ++  L + ++ G  I I 
Sbjct: 239 SYLVMDEADLLLSFGYEEEMIKIRSKLPPTYQCLMTSATLKDDMTTLKKLFMTGPVITIK 298

Query: 485 I--GSLQLSAITTFFKL 529
           +  G L  S   T ++L
Sbjct: 299 LTEGDLPNSDQLTQYQL 315



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD-GPIALVLAPTRELAQQIQQV 140
           GSGKT A+++P +  +  +     G  GP A+++APT+EL  QI ++
Sbjct: 136 GSGKTGAFLIPLVQKLIAESKTNDGSVGPSAVIIAPTKELITQIYKL 182


>U64840-7|AAB04965.1|  340|Caenorhabditis elegans Hypothetical
           protein ZC317.1 protein.
          Length = 340

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDR----QTLM 412
           C  G+L   +E G   L     ++LDEAD+M+D   F P I  I++Q++ +     Q+  
Sbjct: 129 CTIGKLKATIECGDVCLDNLKTIILDEADKMIDNCAFVPDINWILDQLKEENLENLQSCF 188

Query: 413 WSATWPK 433
           +SAT+ K
Sbjct: 189 FSATYNK 195


>U53141-4|AAA96106.1|  528|Caenorhabditis elegans Mutator protein 14
           protein.
          Length = 528

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDR----QTLM 412
           C  G+L   +E G   L     ++LDEAD+M+D   F P I  I++Q++ +     Q+  
Sbjct: 229 CTIGKLKATIECGDVCLDNLKTIILDEADKMIDNCAFGPDINWILDQLKEENLENLQSCF 288

Query: 413 WSATWPK 433
           +SAT+ K
Sbjct: 289 FSATYNK 295


>Z92785-2|CAB07200.1|  344|Caenorhabditis elegans Hypothetical
           protein F31E9.4 protein.
          Length = 344

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 17/64 (26%), Positives = 31/64 (48%)
 Frame = +2

Query: 272 FLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLA 451
           FLE+     + C YL+++E    LD  ++ Q  +++E I  ++  ++    W    K   
Sbjct: 113 FLEQEEKMPRSCEYLIINEISTGLDEFWQHQKDELVESISVEKGIVLSGEAWSNSDKIYN 172

Query: 452 EDYL 463
            DYL
Sbjct: 173 VDYL 176


>Z75546-3|CAA99891.1|  581|Caenorhabditis elegans Hypothetical
           protein R05D11.4 protein.
          Length = 581

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 5/47 (10%)
 Frame = +3

Query: 3   GSGKTLAYILPA---IVHINNQPPIRRGDGP--IALVLAPTRELAQQ 128
           GSGKTLA+ LP    I+ +  +      +    +A+VL PTRELA Q
Sbjct: 173 GSGKTLAFALPVIDEILELKQRADYSSSNSSKLLAVVLEPTRELAAQ 219


>L17337-1|AAP68928.1|  593|Caenorhabditis elegans Hypothetical
           protein ZK686.2 protein.
          Length = 593

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+ Y+LP +  + ++P         A++L P + L  QI      +   S V    
Sbjct: 166 GSGKTICYVLPVLAAVGSKP----SKILQAVILVPVQTLVAQIVDEFKRWNDESGVAKVV 221

Query: 183 VFGGAPKRE-QARDLERG-VEIVIAT 254
              GA   E +AR L      +++AT
Sbjct: 222 SLSGANDFEKEARQLASDPPNVIVAT 247


>AF125963-6|AAK95885.1|  520|Caenorhabditis elegans Hypothetical
           protein Y38A10A.6 protein.
          Length = 520

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG-FEPQIRKIIEQIRPD 397
           C  G+L   +E  T  L     ++LDE+D+M+D+  F   I  +++Q++ D
Sbjct: 228 CTMGKLKASIEDKTILLDNLKMMILDESDKMIDIACFGNDIDWVLDQLQED 278



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 4/47 (8%)
 Frame = +3

Query: 3   GSGKTLAYILPAI-VHINNQP---PIRRGDGPIALVLAPTRELAQQI 131
           G GKT A+++PAI + +  +P    I     P  L+LA T  L +Q+
Sbjct: 139 GIGKTYAFLIPAIEIALRERPLLTNISTTPSPTILILANTNSLVEQL 185


>Z81481-6|CAB63435.1|  344|Caenorhabditis elegans Hypothetical
           protein C38D9.8 protein.
          Length = 344

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 17/64 (26%), Positives = 31/64 (48%)
 Frame = +2

Query: 272 FLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLA 451
           FLE+     + C YL+++E    LD  ++ Q  +++E I  ++  ++    W    K   
Sbjct: 113 FLEQEEKMPRSCEYLIINEFSTGLDEFWQHQKDELVETISVEKGIVLSGEAWSSSDKIYN 172

Query: 452 EDYL 463
            DYL
Sbjct: 173 VDYL 176


>Z50071-3|CAA90407.1|  613|Caenorhabditis elegans Hypothetical
           protein T07D4.4c protein.
          Length = 613

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           G+GKT A++L  +  I+          P  + LAPT ELA+QI +V    G
Sbjct: 258 GTGKTAAFVLTMLCRIDVNLMC-----PQCICLAPTLELAKQIGEVVEKMG 303


>Z50071-2|CAA90406.1|  638|Caenorhabditis elegans Hypothetical
           protein T07D4.4b protein.
          Length = 638

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           G+GKT A++L  +  I+          P  + LAPT ELA+QI +V    G
Sbjct: 283 GTGKTAAFVLTMLCRIDVNLMC-----PQCICLAPTLELAKQIGEVVEKMG 328


>Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical
           protein T07D4.4a protein.
          Length = 1022

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           G+GKT A++L  +  I+          P  + LAPT ELA+QI +V    G
Sbjct: 667 GTGKTAAFVLTMLCRIDVNLMC-----PQCICLAPTLELAKQIGEVVEKMG 712


>U40933-4|AAA81674.1|  778|Caenorhabditis elegans Caenorhabditis
           zeste white 10 (drosophila) homolog protein 1 protein.
          Length = 778

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +1

Query: 133 SKLLQILDTHLMFVTRVCLVVLLKESK 213
           +KLL  LDT  +FVTR C  ++ K +K
Sbjct: 372 AKLLFTLDTDTIFVTRRCFAIVSKANK 398


>AF100656-7|AAF99964.2|  615|Caenorhabditis elegans Hypothetical
           protein F49F1.8 protein.
          Length = 615

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 18/74 (24%), Positives = 38/74 (51%)
 Frame = +1

Query: 412 VVSYLAQRSEETC*GLLGRLHSDQYRIITTFRNHNILQIVDICQEHEKENKLNVLLQEIG 591
           V++ L  +S+ T     G +  D   +  +F +H +    ++  E++KEN+L    Q+ G
Sbjct: 126 VMAVLGIKSDVTISAFSGSMREDLVALRRSFMDH-LGASTEVLTENKKENELRKCKQKDG 184

Query: 592 QSQEPGAKTIIFVE 633
           +S +   + I+ +E
Sbjct: 185 ESVDDFYQRILALE 198


>Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical protein
            F29D11.1 protein.
          Length = 4753

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 281  KGTTNLQRCTYLVLDEADRMLDMGFEPQIR 370
            KG T  +  TY++  + D+++D+  EP ++
Sbjct: 2434 KGRTCEEPDTYIMFSDGDKIIDVAIEPDVK 2463


>M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL receptor-related
            protein protein.
          Length = 4753

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 281  KGTTNLQRCTYLVLDEADRMLDMGFEPQIR 370
            KG T  +  TY++  + D+++D+  EP ++
Sbjct: 2434 KGRTCEEPDTYIMFSDGDKIIDVAIEPDVK 2463


>AL021175-8|CAA15970.2|  201|Caenorhabditis elegans Hypothetical
           protein Y6E2A.9b protein.
          Length = 201

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 18/60 (30%), Positives = 27/60 (45%)
 Frame = +2

Query: 116 VSTTNSASCCRFWTHILCS*HVCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTN 295
           V+ TN +  CR     L   + C    +   A+ GL    +NSH  +GRL+ F+     N
Sbjct: 134 VNYTNRSGNCRTTNQQLLYSYFCATGAA-TTAALGLNMMVKNSHGLAGRLVPFVAVAVAN 192


>AL021175-7|CAE54921.1|  329|Caenorhabditis elegans Hypothetical
           protein Y6E2A.9a protein.
          Length = 329

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 18/60 (30%), Positives = 27/60 (45%)
 Frame = +2

Query: 116 VSTTNSASCCRFWTHILCS*HVCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTN 295
           V+ TN +  CR     L   + C    +   A+ GL    +NSH  +GRL+ F+     N
Sbjct: 134 VNYTNRSGNCRTTNQQLLYSYFCATGAA-TTAALGLNMMVKNSHGLAGRLVPFVAVAVAN 192


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,244,070
Number of Sequences: 27780
Number of extensions: 348706
Number of successful extensions: 1145
Number of sequences better than 10.0: 61
Number of HSP's better than 10.0 without gapping: 1019
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1099
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1550199966
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -