SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120007.Seq
         (661 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF039047-10|AAB94229.2|  400|Caenorhabditis elegans Hypothetical...    36   0.034
Z66567-9|CAA91495.1| 1268|Caenorhabditis elegans Hypothetical pr...    34   0.078
Z66562-7|CAA91467.1| 1268|Caenorhabditis elegans Hypothetical pr...    34   0.078
X65055-1|CAA46191.1| 1254|Caenorhabditis elegans P-glycoprotein ...    34   0.078
Z49887-1|CAA90058.1|  710|Caenorhabditis elegans Hypothetical pr...    31   0.72 
U97002-4|AAB52267.1|  630|Caenorhabditis elegans Hypothetical pr...    30   1.7  
AL021483-1|CAA16348.1|  272|Caenorhabditis elegans Hypothetical ...    30   1.7  
U39647-1|AAA80375.2|  351|Caenorhabditis elegans Hypothetical pr...    29   2.9  
AL110485-18|CAB60366.1|  108|Caenorhabditis elegans Hypothetical...    29   3.9  
AC024876-2|AAF60894.2|  186|Caenorhabditis elegans Hypothetical ...    29   3.9  
AF125964-1|AAD14753.1|  471|Caenorhabditis elegans Hypothetical ...    28   5.1  
Z70686-2|CAA94610.1|  570|Caenorhabditis elegans Hypothetical pr...    28   6.8  
U20142-2|AAB60235.1|  570|Caenorhabditis elegans SPE-26 protein ...    28   6.8  
AY130758-3|AAN61519.1| 10578|Caenorhabditis elegans 1MDa_1 prote...    28   6.8  
AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 prote...    28   6.8  
AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 prote...    28   6.8  
AF040642-4|AAN73873.2|  319|Caenorhabditis elegans Hypothetical ...    28   6.8  
Z82270-3|CAB63205.1|  667|Caenorhabditis elegans Hypothetical pr...    27   8.9  

>AF039047-10|AAB94229.2|  400|Caenorhabditis elegans Hypothetical
           protein K11D12.9 protein.
          Length = 400

 Score = 35.5 bits (78), Expect = 0.034
 Identities = 22/82 (26%), Positives = 39/82 (47%)
 Frame = +2

Query: 185 DRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSA 364
           D VRL  T   + E D  E  S F+   + I H+ N++    +++++LKRL+  + Q   
Sbjct: 112 DIVRLLATLEREKERDRKEVDSQFTILKNRINHLENEKEQCLSEVQELKRLLEDSEQDLK 171

Query: 365 KSDAEIAKALSVVHQDLDEADK 430
               E+ + +    +  D  DK
Sbjct: 172 DCKDEMNRLMEERVETADALDK 193


>Z66567-9|CAA91495.1| 1268|Caenorhabditis elegans Hypothetical
           protein ZK455.7 protein.
          Length = 1268

 Score = 34.3 bits (75), Expect = 0.078
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = +3

Query: 18  IFGTVLGIAGSTINNHLKMAEFRDMMEQQMARSASVLYTIAGGGTASRADITEAMKTEFA 197
           I G++LG AG T++  L+M  FR++M+Q  +      + +  G   SR   T+A   + A
Sbjct: 767 ISGSLLGKAGETMSGRLRMDVFRNIMQQDASYFDDSRHNV--GSLTSRL-ATDAPNVQAA 823

Query: 198 YQEQLAQNL 224
             ++LA+ L
Sbjct: 824 IDQRLAEVL 832


>Z66562-7|CAA91467.1| 1268|Caenorhabditis elegans Hypothetical
           protein ZK455.7 protein.
          Length = 1268

 Score = 34.3 bits (75), Expect = 0.078
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = +3

Query: 18  IFGTVLGIAGSTINNHLKMAEFRDMMEQQMARSASVLYTIAGGGTASRADITEAMKTEFA 197
           I G++LG AG T++  L+M  FR++M+Q  +      + +  G   SR   T+A   + A
Sbjct: 767 ISGSLLGKAGETMSGRLRMDVFRNIMQQDASYFDDSRHNV--GSLTSRL-ATDAPNVQAA 823

Query: 198 YQEQLAQNL 224
             ++LA+ L
Sbjct: 824 IDQRLAEVL 832


>X65055-1|CAA46191.1| 1254|Caenorhabditis elegans P-glycoprotein C
           protein.
          Length = 1254

 Score = 34.3 bits (75), Expect = 0.078
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = +3

Query: 18  IFGTVLGIAGSTINNHLKMAEFRDMMEQQMARSASVLYTIAGGGTASRADITEAMKTEFA 197
           I G++LG AG T++  L+M  FR++M+Q  +      + +  G   SR   T+A   + A
Sbjct: 753 ISGSLLGKAGETMSGRLRMDVFRNIMQQDASYFDDSRHNV--GSLTSRL-ATDAPNVQAA 809

Query: 198 YQEQLAQNL 224
             ++LA+ L
Sbjct: 810 IDQRLAEVL 818


>Z49887-1|CAA90058.1|  710|Caenorhabditis elegans Hypothetical
           protein F09B9.1 protein.
          Length = 710

 Score = 31.1 bits (67), Expect = 0.72
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = -2

Query: 339 INRLRSFI*VSTKCS*LCMCSIREVCLLKDDLYSPASTSNFG-LVVPG 199
           I  L  F  VS  C     CS++E+ +LK +LY+     +FG L VPG
Sbjct: 46  IKSLELFAGVSEACLKKQTCSLKELKILKANLYAIQELDSFGKLPVPG 93


>U97002-4|AAB52267.1|  630|Caenorhabditis elegans Hypothetical
           protein K09H11.4 protein.
          Length = 630

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 6/58 (10%)
 Frame = +2

Query: 35  RYSRFDDKQSPEDGRVQGHDGAADG------PERERPVHHRGGRDRQPGRHHGGDEDR 190
           R  RF DK S ++ + +   G+  G      PE+ R   H+  RDR+P R   G+ ++
Sbjct: 279 RGGRFVDKPSEKEEQEKFFRGSDAGGGEDREPEKGRKQEHKESRDRRPARGDSGEVEK 336



 Score = 29.1 bits (62), Expect = 2.9
 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 9/66 (13%)
 Frame = +2

Query: 20  FWHGARYSRFDDKQSPEDGRVQGHDGAADG-PER--ERPVHHRG------GRDRQPGRHH 172
           F+ G+     +D++ PE GR Q H  + D  P R     V  RG      GRD Q  R H
Sbjct: 296 FFRGSDAGGGEDRE-PEKGRKQEHKESRDRRPARGDSGEVEKRGRGEKAEGRDEQERRSH 354

Query: 173 GGDEDR 190
           G +E R
Sbjct: 355 GSEERR 360


>AL021483-1|CAA16348.1|  272|Caenorhabditis elegans Hypothetical
           protein Y38H8A.1 protein.
          Length = 272

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 29/131 (22%), Positives = 53/131 (40%), Gaps = 4/131 (3%)
 Frame = +2

Query: 224 EVDAGEYKSSFSKQTSLIE---HMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKAL 394
           + D    KS   ++TS  E   ++HN   L E    +   +  +      K+ AE+ K +
Sbjct: 117 KTDTRSEKSKIEEKTSRDEGSNNVHNDRDLFEALQVEKPDICGSCPPIWMKNTAEM-KDI 175

Query: 395 SVVHQDLDEA-DKDRDLEPAKVSLEPNQILTGIGIIVCFR*YSATFWAESVEMSIFSPDS 571
              H+ +        D   A+  ++ + +      IVC   +    W ES    + +P +
Sbjct: 176 CSNHESVSAFFSMTMDRRDAQNVVDSSDVKECTRTIVCSEPHMLVKWHESELCDVHAPST 235

Query: 572 GSLILESGHIF 604
           GSLI +  + F
Sbjct: 236 GSLISDISNTF 246


>U39647-1|AAA80375.2|  351|Caenorhabditis elegans Hypothetical
           protein C44E12.1 protein.
          Length = 351

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 15/50 (30%), Positives = 29/50 (58%)
 Frame = +2

Query: 338 IVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQILTG 487
           +VTA+   +K+D ++A+AL ++    +E D    +E  K+ + P  +L G
Sbjct: 108 MVTAATIISKTDEDVARALGLLFVVGEEFDHIGMIEANKLEILPEYLLVG 157


>AL110485-18|CAB60366.1|  108|Caenorhabditis elegans Hypothetical
           protein Y46G5A.23 protein.
          Length = 108

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 17/49 (34%), Positives = 20/49 (40%)
 Frame = +2

Query: 74  GRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPK 220
           G+V G  G   G    R   H GG  R  G H GG   R  + G   P+
Sbjct: 61  GQVLGGGGGGGGRRHHRGHRHGGGGHRHGG-HRGGGGGRGMVIGAERPQ 108


>AC024876-2|AAF60894.2|  186|Caenorhabditis elegans Hypothetical
           protein Y94H6A.3 protein.
          Length = 186

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 7/69 (10%)
 Frame = +2

Query: 131 HHRGGRDRQPGRH-----HGGDEDRVR--LPGTTSPKFEVDAGEYKSSFSKQTSLIEHMH 289
           + R  RDR   RH     H  D  R++  +  T     + DA    S FS++   +E + 
Sbjct: 8   YDRDRRDRDRDRHRSNKDHSSDVARMKEKMRSTLESARKSDAPSTSSDFSRKPQKVEELT 67

Query: 290 NQEHLVETQ 316
             EHL  T+
Sbjct: 68  PAEHLARTR 76


>AF125964-1|AAD14753.1|  471|Caenorhabditis elegans Hypothetical
           protein W03G1.5 protein.
          Length = 471

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 18/79 (22%), Positives = 29/79 (36%), Gaps = 1/79 (1%)
 Frame = +2

Query: 50  DDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGT-TSPKFE 226
           D+    + G   G   ++ G  R      RGGR  + G          R PG    P+ +
Sbjct: 147 DENDRKKKGERSGSSSSSSGSSRSPSRGRRGGRGGRSGSSSSSSSSESRSPGRHEEPEKQ 206

Query: 227 VDAGEYKSSFSKQTSLIEH 283
               E K    +++  +EH
Sbjct: 207 GKKEELKQLKKQKSEGVEH 225


>Z70686-2|CAA94610.1|  570|Caenorhabditis elegans Hypothetical
           protein R10H10.2 protein.
          Length = 570

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = +2

Query: 260 KQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRD 439
           ++T +IE + NQ    + + +D  R ++ ++      D +IAK+LS  H  L  A + RD
Sbjct: 185 QETQIIEVI-NQWIAADFENRDKFRPMLMSTVRFLALDQQIAKSLSQFHPSLKPARRTRD 243

Query: 440 L 442
           +
Sbjct: 244 V 244


>U20142-2|AAB60235.1|  570|Caenorhabditis elegans SPE-26 protein
           protein.
          Length = 570

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = +2

Query: 260 KQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRD 439
           ++T +IE + NQ    + + +D  R ++ ++      D +IAK+LS  H  L  A + RD
Sbjct: 185 QETQIIEVI-NQWIAADFENRDKFRPMLMSTVRFLALDQQIAKSLSQFHPSLKPARRTRD 243

Query: 440 L 442
           +
Sbjct: 244 V 244


>AY130758-3|AAN61519.1| 10578|Caenorhabditis elegans 1MDa_1 protein
            protein.
          Length = 10578

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 29/124 (23%), Positives = 51/124 (41%), Gaps = 5/124 (4%)
 Frame = +2

Query: 113  ERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHN 292
            E+  PV  +   + QP      +   V++P T+SP  E    +     SK+TS +E    
Sbjct: 5927 EKLAPVESKETSEVQPAEIV--EHKDVQVPETSSPTVEPTVEKLAPVESKETSEVEPAEI 5984

Query: 293  QEH----LVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDR-DLEPAKV 457
             E     + ET    ++  +   +   +K  +E+  A  V H+D+   +     +EP   
Sbjct: 5985 VEQKDVPVPETSAPTVEPTVEKLAPVESKETSEVQPAEIVEHKDVQVPETSAPTVEPTIE 6044

Query: 458  SLEP 469
             L P
Sbjct: 6045 KLAP 6048



 Score = 27.5 bits (58), Expect = 8.9
 Identities = 23/102 (22%), Positives = 43/102 (42%), Gaps = 1/102 (0%)
 Frame = +2

Query: 179  DEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQS 358
            ++  V +P T++P  E    +     SK+TS +E     E    T  +++K L+      
Sbjct: 5338 EQKDVPVPETSAPTVEPTVEKLAPVDSKETSEVEPAEIVEQKDVTCEEEIKELLTEVEVE 5397

Query: 359  SAKSDAEIAKALSVVHQDLDEADKDRDLEPAKVS-LEPNQIL 481
               S AE+    +         +K   +E  + S +EP +I+
Sbjct: 5398 LLFSQAEVFSGSTAAPAQEPTVEKLAPVESKETSEVEPAEIV 5439


>AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 protein
            protein.
          Length = 18519

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 29/124 (23%), Positives = 51/124 (41%), Gaps = 5/124 (4%)
 Frame = +2

Query: 113  ERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHN 292
            E+  PV  +   + QP      +   V++P T+SP  E    +     SK+TS +E    
Sbjct: 5947 EKLAPVESKETSEVQPAEIV--EHKDVQVPETSSPTVEPTVEKLAPVESKETSEVEPAEI 6004

Query: 293  QEH----LVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDR-DLEPAKV 457
             E     + ET    ++  +   +   +K  +E+  A  V H+D+   +     +EP   
Sbjct: 6005 VEQKDVPVPETSAPTVEPTVEKLAPVESKETSEVQPAEIVEHKDVQVPETSAPTVEPTIE 6064

Query: 458  SLEP 469
             L P
Sbjct: 6065 KLAP 6068


>AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 protein
            protein.
          Length = 18534

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 29/124 (23%), Positives = 51/124 (41%), Gaps = 5/124 (4%)
 Frame = +2

Query: 113  ERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHN 292
            E+  PV  +   + QP      +   V++P T+SP  E    +     SK+TS +E    
Sbjct: 5947 EKLAPVESKETSEVQPAEIV--EHKDVQVPETSSPTVEPTVEKLAPVESKETSEVEPAEI 6004

Query: 293  QEH----LVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDR-DLEPAKV 457
             E     + ET    ++  +   +   +K  +E+  A  V H+D+   +     +EP   
Sbjct: 6005 VEQKDVPVPETSAPTVEPTVEKLAPVESKETSEVQPAEIVEHKDVQVPETSAPTVEPTIE 6064

Query: 458  SLEP 469
             L P
Sbjct: 6065 KLAP 6068


>AF040642-4|AAN73873.2|  319|Caenorhabditis elegans Hypothetical
           protein C50D2.8 protein.
          Length = 319

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = +2

Query: 137 RGGRDRQPGRHHGGDEDR 190
           R  RDR+  RHHG D DR
Sbjct: 294 RDSRDRREHRHHGYDRDR 311


>Z82270-3|CAB63205.1|  667|Caenorhabditis elegans Hypothetical
           protein F53H2.3 protein.
          Length = 667

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = -2

Query: 591 DSKIKLPESGLNIDISTDSAQNVAE 517
           DS +K+P+SGLN+D S    + +AE
Sbjct: 612 DSTMKMPKSGLNLDESGGKLKFLAE 636


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,693,527
Number of Sequences: 27780
Number of extensions: 319873
Number of successful extensions: 1435
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 1231
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1431
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1476380920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -