SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120006.Seq
         (617 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U42845-1|AAA83599.1|  196|Caenorhabditis elegans Ribosomal prote...   135   3e-32
U64844-3|AAB18306.1|  196|Caenorhabditis elegans Ribosomal prote...   134   6e-32
U88176-4|ABB51191.1|  427|Caenorhabditis elegans Hypothetical pr...    30   1.2  
AF024495-1|AAB70338.3|  399|Caenorhabditis elegans Nuclear hormo...    29   2.7  
AL161712-18|CAC70140.1|  448|Caenorhabditis elegans Hypothetical...    29   3.5  
Z81465-3|CAC42253.4|  800|Caenorhabditis elegans Hypothetical pr...    28   4.6  

>U42845-1|AAA83599.1|  196|Caenorhabditis elegans Ribosomal protein,
           large subunitprotein 11.2 protein.
          Length = 196

 Score =  135 bits (326), Expect = 3e-32
 Identities = 63/91 (69%), Positives = 74/91 (81%)
 Frame = +1

Query: 235 CPLYSPRAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLD 414
           C +  P  KAEEILE+GLKV+EYEL ++NFS TGNFGFG+QEHIDLGIKYDPSIGIYG+D
Sbjct: 79  CTVRGP--KAEEILEKGLKVKEYELYKENFSDTGNFGFGVQEHIDLGIKYDPSIGIYGMD 136

Query: 415 FYVVLGRPGFNVAHRRRKTGKVGFPHRLTKE 507
           FYVVL R G  +A RRR  G+VG  HR+ +E
Sbjct: 137 FYVVLDRAGRRIAKRRRAPGRVGPSHRVERE 167



 Score =  134 bits (323), Expect = 6e-32
 Identities = 66/85 (77%), Positives = 72/85 (84%)
 Frame = +2

Query: 23  KGEEGSEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVR 202
           K  E  E  ++NVMR L I+KLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSKARYTVR
Sbjct: 6   KQTEIREKKARNVMRELKIQKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVR 65

Query: 203 SFGIRRNEKIAVHCTVRELKQKKSL 277
           +FGIRRNEKIAVHCTVR  K ++ L
Sbjct: 66  TFGIRRNEKIAVHCTVRGPKAEEIL 90



 Score = 27.9 bits (59), Expect = 6.1
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +3

Query: 480 GISPPPHKGSAMKWFQQKYDG 542
           G S    +  ++KWFQQKYDG
Sbjct: 159 GPSHRVEREESIKWFQQKYDG 179


>U64844-3|AAB18306.1|  196|Caenorhabditis elegans Ribosomal protein,
           large subunitprotein 11.1 protein.
          Length = 196

 Score =  134 bits (323), Expect = 6e-32
 Identities = 62/91 (68%), Positives = 73/91 (80%)
 Frame = +1

Query: 235 CPLYSPRAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLD 414
           C +  P  KAEEILE+GLKV+EYEL ++NFS TGNFGFG+QEHIDLGIKYDP IGIYG+D
Sbjct: 79  CTVRGP--KAEEILEKGLKVKEYELFKENFSDTGNFGFGVQEHIDLGIKYDPGIGIYGMD 136

Query: 415 FYVVLGRPGFNVAHRRRKTGKVGFPHRLTKE 507
           FYVVL R G  V+ RRR  G++G  HR+ KE
Sbjct: 137 FYVVLNRNGVRVSKRRRAPGRIGPSHRVDKE 167



 Score =  133 bits (322), Expect = 8e-32
 Identities = 66/85 (77%), Positives = 71/85 (83%)
 Frame = +2

Query: 23  KGEEGSEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVR 202
           K  E  E   +NVMR L I+KLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSKARYTVR
Sbjct: 6   KQTEIREKKGRNVMRELKIQKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVR 65

Query: 203 SFGIRRNEKIAVHCTVRELKQKKSL 277
           +FGIRRNEKIAVHCTVR  K ++ L
Sbjct: 66  TFGIRRNEKIAVHCTVRGPKAEEIL 90



 Score = 28.7 bits (61), Expect = 3.5
 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 3/27 (11%)
 Frame = +3

Query: 471 RKSGISPPPH---KGSAMKWFQQKYDG 542
           R  G   P H   K   +KWFQQKYDG
Sbjct: 153 RAPGRIGPSHRVDKEETIKWFQQKYDG 179


>U88176-4|ABB51191.1|  427|Caenorhabditis elegans Hypothetical
           protein F18F11.3 protein.
          Length = 427

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +1

Query: 385 DPSIGIYGLDFYVVLGRPGFNVAHRRRKTGKVGFPHRLTKEV 510
           DP  GI G+  + V G   F +A R+  +GK     RL K++
Sbjct: 160 DPDTGISGISRFSVEGDSSFTLAKRKCSSGKCSTQLRLAKKL 201


>AF024495-1|AAB70338.3|  399|Caenorhabditis elegans Nuclear hormone
           receptor familyprotein 125 protein.
          Length = 399

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +1

Query: 232 CCPLYSPRAKAEEILERGLKVREYELRRDNFSATGNF 342
           C   +  R + ++  E G+   +++  RD+F ATG F
Sbjct: 55  CSRNFCKRCRLKKCREMGMDTTKFQYNRDSFRATGQF 91


>AL161712-18|CAC70140.1|  448|Caenorhabditis elegans Hypothetical
           protein Y66D12A.23 protein.
          Length = 448

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = +1

Query: 262 AEEILERGLKVREY-ELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGI 402
           AEE+  RG  +  Y E+RR     TG FG G +  +   I +  S+ +
Sbjct: 359 AEELQRRGCGIDWYLEMRRRGQPPTGGFGIGFERMLQYLIFFRKSLNL 406


>Z81465-3|CAC42253.4|  800|Caenorhabditis elegans Hypothetical
           protein C09F9.3 protein.
          Length = 800

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 3/42 (7%)
 Frame = -2

Query: 256 LSDCTMDSNLFITTDTKRPHCIPSLGK---YRLLSCELLQHL 140
           +S CT+D   F   D+K+  C+ S+ K   Y +++ E+  H+
Sbjct: 204 MSICTIDGQRFSLGDSKKNFCLQSVSKAFNYAIVASEIGSHV 245


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,315,773
Number of Sequences: 27780
Number of extensions: 290548
Number of successful extensions: 778
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 747
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 778
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1342816466
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -