SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120005.Seq
         (647 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81465-4|CAB03866.3|  613|Caenorhabditis elegans Hypothetical pr...    29   2.1  
AL032646-13|CAA21687.3|  613|Caenorhabditis elegans Hypothetical...    29   2.1  
Z82260-3|CAB05131.1|  346|Caenorhabditis elegans Hypothetical pr...    29   3.8  
Z79639-1|CAB01916.1| 2948|Caenorhabditis elegans Hypothetical pr...    29   3.8  
U97593-7|AAB52878.1|  591|Caenorhabditis elegans Prion-like-(q/n...    28   6.6  
U97593-6|AAB52879.2|  925|Caenorhabditis elegans Prion-like-(q/n...    28   6.6  
U97593-5|AAB52880.1| 1175|Caenorhabditis elegans Prion-like-(q/n...    28   6.6  
U12966-3|AAA20614.1|  128|Caenorhabditis elegans Temporarily ass...    28   6.6  
AF067608-5|AAK95865.1|  523|Caenorhabditis elegans Hypothetical ...    27   8.7  

>Z81465-4|CAB03866.3|  613|Caenorhabditis elegans Hypothetical
           protein Y54E2A.1 protein.
          Length = 613

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 6/82 (7%)
 Frame = +1

Query: 76  GNNMALMPVGMAPRQMRVNRCIFASIVSFDAC-ITYKSPCSPDAYHDDGW----FICNS- 237
           GN+M +  V    R   V     AS+ + D C I +  P     Y    W    F C S 
Sbjct: 89  GNSMVIFVVNRFKRMRNVTNIFLASLSTADLCLIWFCVPIMFMKYMSHTWSMGRFACYSV 148

Query: 238 HLIKRLKCQKWFCPFSTKTTIN 303
           H I++  C   FC   T T I+
Sbjct: 149 HYIQQFTC---FCSVLTMTMIS 167


>AL032646-13|CAA21687.3|  613|Caenorhabditis elegans Hypothetical
           protein Y54E2A.1 protein.
          Length = 613

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 6/82 (7%)
 Frame = +1

Query: 76  GNNMALMPVGMAPRQMRVNRCIFASIVSFDAC-ITYKSPCSPDAYHDDGW----FICNS- 237
           GN+M +  V    R   V     AS+ + D C I +  P     Y    W    F C S 
Sbjct: 89  GNSMVIFVVNRFKRMRNVTNIFLASLSTADLCLIWFCVPIMFMKYMSHTWSMGRFACYSV 148

Query: 238 HLIKRLKCQKWFCPFSTKTTIN 303
           H I++  C   FC   T T I+
Sbjct: 149 HYIQQFTC---FCSVLTMTMIS 167


>Z82260-3|CAB05131.1|  346|Caenorhabditis elegans Hypothetical
           protein C32H11.4 protein.
          Length = 346

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +1

Query: 100 VGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYH 210
           +GM P  + + + +FA+  S D    + SP  P+ Y+
Sbjct: 146 IGMQPHVLNITQDLFAADFSSDKVALFVSPADPNDYY 182


>Z79639-1|CAB01916.1| 2948|Caenorhabditis elegans Hypothetical
           protein F54E4.1 protein.
          Length = 2948

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 25/113 (22%), Positives = 48/113 (42%), Gaps = 1/113 (0%)
 Frame = +3

Query: 282 FDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEE 461
           FDE  N+FK+    HL         +++  +  N + V+ L ++   E L F       +
Sbjct: 18  FDEIKNRFKICKNDHLKHQTSMNAHQVITGALNNGENVYALGNI---EGLTFTACAVGSD 74

Query: 462 AVNVICDNLKYTEVFTAARN-ALYTAFTQLQEAF*TPQTRTRFVRVCRATNCG 617
            V ++  +    ++   ++N  L ++ +  QE      T    V++  ATN G
Sbjct: 75  VV-ILDSDFNRVQIIPESKNHLLVSSLSCCQETGKIAVTYGNLVKILEATNSG 126


>U97593-7|AAB52878.1|  591|Caenorhabditis elegans
           Prion-like-(q/n-rich)-domain-bearingprotein protein 22,
           isoform b protein.
          Length = 591

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +2

Query: 401 SKQYDASRTTNLSFDI*QXXXXXXYMRQSKIYRSFHSGTQRVIHSVYATTR 553
           ++QY ++ T+N      Q      Y +Q   Y+S HS  QR+++S Y T +
Sbjct: 28  TRQYSSNATSNYPSQTQQ------YQQQQHQYQSDHSNAQRLLNSGYNTNQ 72


>U97593-6|AAB52879.2|  925|Caenorhabditis elegans
           Prion-like-(q/n-rich)-domain-bearingprotein protein 22,
           isoform c protein.
          Length = 925

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +2

Query: 401 SKQYDASRTTNLSFDI*QXXXXXXYMRQSKIYRSFHSGTQRVIHSVYATTR 553
           ++QY ++ T+N      Q      Y +Q   Y+S HS  QR+++S Y T +
Sbjct: 447 TRQYSSNATSNYPSQTQQ------YQQQQHQYQSDHSNAQRLLNSGYNTNQ 491


>U97593-5|AAB52880.1| 1175|Caenorhabditis elegans
           Prion-like-(q/n-rich)-domain-bearingprotein protein 22,
           isoform a protein.
          Length = 1175

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +2

Query: 401 SKQYDASRTTNLSFDI*QXXXXXXYMRQSKIYRSFHSGTQRVIHSVYATTR 553
           ++QY ++ T+N      Q      Y +Q   Y+S HS  QR+++S Y T +
Sbjct: 612 TRQYSSNATSNYPSQTQQ------YQQQQHQYQSDHSNAQRLLNSGYNTNQ 656


>U12966-3|AAA20614.1|  128|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 174 protein.
          Length = 128

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 9/18 (50%), Positives = 14/18 (77%)
 Frame = +1

Query: 541 RNYKKHSRHHKPEHVLFA 594
           +++KKH  H +PEHV +A
Sbjct: 72  KDHKKHMSHERPEHVEYA 89


>AF067608-5|AAK95865.1|  523|Caenorhabditis elegans Hypothetical
           protein B0511.8 protein.
          Length = 523

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +1

Query: 490 NIPKFSQRHATRYTQRLRNYKKHSRHHKPEHVL 588
           N+P  S   +T Y  R   Y+K  +HH+P+H+L
Sbjct: 41  NVPAKSANASTVY--RPPYYRKPHQHHEPKHML 71


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,598,910
Number of Sequences: 27780
Number of extensions: 291945
Number of successful extensions: 801
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 776
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 801
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1434198608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -