SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120004.Seq
         (720 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF016685-1|AAG24144.2|  300|Caenorhabditis elegans Hypothetical ...    34   0.089
Z69883-1|CAA93743.1|  829|Caenorhabditis elegans Hypothetical pr...    30   1.9  
Z81465-4|CAB03866.3|  613|Caenorhabditis elegans Hypothetical pr...    29   2.5  
AL032646-13|CAA21687.3|  613|Caenorhabditis elegans Hypothetical...    29   2.5  
Z82260-3|CAB05131.1|  346|Caenorhabditis elegans Hypothetical pr...    29   4.4  
Z92834-1|CAB07382.1|  564|Caenorhabditis elegans Hypothetical pr...    28   5.8  
U12966-3|AAA20614.1|  128|Caenorhabditis elegans Temporarily ass...    28   7.7  

>AF016685-1|AAG24144.2|  300|Caenorhabditis elegans Hypothetical
           protein F59E11.8 protein.
          Length = 300

 Score = 34.3 bits (75), Expect = 0.089
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +3

Query: 456 EEAVNVICDNLKYTEVSQRHATRYTQRLRNYKKHSRHHK 572
           E  +N++ DNL    V Q+ ATRY+ RL    K S+ +K
Sbjct: 227 ERLLNILADNLHEYYVEQKDATRYSYRLTKILKISQQYK 265


>Z69883-1|CAA93743.1|  829|Caenorhabditis elegans Hypothetical
           protein C27C12.7 protein.
          Length = 829

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 3/80 (3%)
 Frame = +3

Query: 354 KRILIPSATNYQEVFNLNSMMQAEQL--IFHLIYNNEEAVNVICDN-LKYTEVSQRHATR 524
           +R L   A N Q   N N +  A  +  + +L+ + E   NV   N  +++E  Q++   
Sbjct: 730 ERYLGQPAENLQGYINTNVIPHARNVTNVKYLLAHGERDDNVHYQNSARWSEALQQNGIH 789

Query: 525 YTQRLRNYKKHSRHHKPEHV 584
           +TQ +   + HS  HK  H+
Sbjct: 790 FTQLVYANEAHSLSHKLFHL 809


>Z81465-4|CAB03866.3|  613|Caenorhabditis elegans Hypothetical
           protein Y54E2A.1 protein.
          Length = 613

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 6/82 (7%)
 Frame = +1

Query: 76  GNNMALMPVGMAPRQMRVNRCIFASIVSFDAC-ITYKSPCSPDAYHDDGW----FICNS- 237
           GN+M +  V    R   V     AS+ + D C I +  P     Y    W    F C S 
Sbjct: 89  GNSMVIFVVNRFKRMRNVTNIFLASLSTADLCLIWFCVPIMFMKYMSHTWSMGRFACYSV 148

Query: 238 HLIKRLKCQKWFCPFSTKTTIN 303
           H I++  C   FC   T T I+
Sbjct: 149 HYIQQFTC---FCSVLTMTMIS 167


>AL032646-13|CAA21687.3|  613|Caenorhabditis elegans Hypothetical
           protein Y54E2A.1 protein.
          Length = 613

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 6/82 (7%)
 Frame = +1

Query: 76  GNNMALMPVGMAPRQMRVNRCIFASIVSFDAC-ITYKSPCSPDAYHDDGW----FICNS- 237
           GN+M +  V    R   V     AS+ + D C I +  P     Y    W    F C S 
Sbjct: 89  GNSMVIFVVNRFKRMRNVTNIFLASLSTADLCLIWFCVPIMFMKYMSHTWSMGRFACYSV 148

Query: 238 HLIKRLKCQKWFCPFSTKTTIN 303
           H I++  C   FC   T T I+
Sbjct: 149 HYIQQFTC---FCSVLTMTMIS 167


>Z82260-3|CAB05131.1|  346|Caenorhabditis elegans Hypothetical
           protein C32H11.4 protein.
          Length = 346

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +1

Query: 100 VGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYH 210
           +GM P  + + + +FA+  S D    + SP  P+ Y+
Sbjct: 146 IGMQPHVLNITQDLFAADFSSDKVALFVSPADPNDYY 182


>Z92834-1|CAB07382.1|  564|Caenorhabditis elegans Hypothetical
           protein F39B2.1 protein.
          Length = 564

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +3

Query: 519 TRYTQRLRNYKKHSRHHKPEHVLFACVARRIAFFRRDQ 632
           T+      N ++H+RHH  E VL AC      F RRD+
Sbjct: 300 TQVADSKANLRRHARHHSGEKVL-ACPFCARFFSRRDK 336


>U12966-3|AAA20614.1|  128|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 174 protein.
          Length = 128

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 9/18 (50%), Positives = 14/18 (77%)
 Frame = +3

Query: 540 RNYKKHSRHHKPEHVLFA 593
           +++KKH  H +PEHV +A
Sbjct: 72  KDHKKHMSHERPEHVEYA 89


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,073,447
Number of Sequences: 27780
Number of extensions: 331201
Number of successful extensions: 883
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 843
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 883
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1687292480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -