SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120003.Seq
         (731 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF022985-2|AAB69972.2|  195|Caenorhabditis elegans Hypothetical ...    32   0.36 
AC006769-9|AAF60585.2|  779|Caenorhabditis elegans Hypothetical ...    29   3.4  
AC006645-2|AAF39844.2|  796|Caenorhabditis elegans Hypothetical ...    29   3.4  
Z81513-12|CAE17799.1|  417|Caenorhabditis elegans Hypothetical p...    28   7.8  
Z29094-16|CAA82345.2|  184|Caenorhabditis elegans Hypothetical p...    28   7.8  

>AF022985-2|AAB69972.2|  195|Caenorhabditis elegans Hypothetical
           protein T15B7.17 protein.
          Length = 195

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = -1

Query: 650 DKVTCAYSIHSSSDQFFISASQYXXXXXXXX*LYLNPLTIKLLINAVLQWDNFQTS 483
           D++T  +   S SD F+I AS+           Y N L +++ +N  L+  N+QTS
Sbjct: 44  DEMTSGHG-RSFSDFFYIPASEIDYYASLMRIFYANKLFLEIAVNKFLKSVNYQTS 98


>AC006769-9|AAF60585.2|  779|Caenorhabditis elegans Hypothetical
           protein Y45G12C.11 protein.
          Length = 779

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = -1

Query: 620 SSSDQFFISASQYXXXXXXXX*LYLNPLTIKLLINAVLQWDNFQTS 483
           S SD F+I  S+           Y N L +++ +N  L+  NFQTS
Sbjct: 661 SVSDFFYIPTSESEYYASLMRIFYENNLFLEIAVNKFLKSVNFQTS 706


>AC006645-2|AAF39844.2|  796|Caenorhabditis elegans Hypothetical
           protein F56A4.6 protein.
          Length = 796

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = -1

Query: 620 SSSDQFFISASQYXXXXXXXX*LYLNPLTIKLLINAVLQWDNFQTS 483
           S SD F+I  S+           Y N L +++ +N  L+  NFQTS
Sbjct: 678 SVSDFFYIPTSESEYYASLMRIFYENNLFLEIAVNKFLKSVNFQTS 723


>Z81513-12|CAE17799.1|  417|Caenorhabditis elegans Hypothetical
           protein F26D2.16 protein.
          Length = 417

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 2/70 (2%)
 Frame = +2

Query: 50  DLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSV--DVGSISELQKFNFKINRLTSYI 223
           D L +  FS+  C    +    V++ + N  + K+V  DV SIS+   F     R+T  +
Sbjct: 318 DRLLSYKFSYKGCGRM-VSKEEVIEHIINLPLRKNVELDVKSISDSPSFYLIRMRITGLL 376

Query: 224 SNIFEYEFVV 253
           S  FE  F V
Sbjct: 377 SKPFEISFKV 386


>Z29094-16|CAA82345.2|  184|Caenorhabditis elegans Hypothetical
           protein C07A9.9 protein.
          Length = 184

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 4/44 (9%)
 Frame = +1

Query: 547 KYNQVDDHVV----CEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           +Y  VDD V     C +C      W  D+C +  H +L  +C Y
Sbjct: 59  EYQYVDDDVPNSERCHFCMKRKGRWMGDDCSD--HSSLCKHCCY 100


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,438,598
Number of Sequences: 27780
Number of extensions: 309771
Number of successful extensions: 953
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 911
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 953
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1714401074
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -