SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120002.Seq
         (725 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF016670-8|AAB66101.1|  783|Caenorhabditis elegans Hypothetical ...    28   5.9  
Z81112-1|CAB03272.2|  673|Caenorhabditis elegans Hypothetical pr...    28   7.8  
Z49127-11|CAA88952.2|  452|Caenorhabditis elegans Hypothetical p...    28   7.8  
AL033535-4|CAA22134.2|  452|Caenorhabditis elegans Hypothetical ...    28   7.8  

>AF016670-8|AAB66101.1|  783|Caenorhabditis elegans Hypothetical
           protein K02F6.1 protein.
          Length = 783

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 3/62 (4%)
 Frame = +1

Query: 25  KNLEFTTSFGTCIPLRLRIQNKTDVKTDFIAEVSHSSIQIDKECCLGPLE---KGKILVW 195
           + ++FT   G+ I L + +QN   +    + +V H      K CC    E   KG++LVW
Sbjct: 367 QQIDFTFDTGSDITL-ISVQNWQKIGKPHLEKVHH------KICCANGTEIAVKGRVLVW 419

Query: 196 FE 201
           F+
Sbjct: 420 FK 421


>Z81112-1|CAB03272.2|  673|Caenorhabditis elegans Hypothetical
           protein T02B5.1 protein.
          Length = 673

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = -3

Query: 108 ICFHIGFILYSKP*RYTSTKTCRK 37
           +C HIG++LY +P   T +K C+K
Sbjct: 367 LCDHIGYVLYEEP--ETFSKKCQK 388


>Z49127-11|CAA88952.2|  452|Caenorhabditis elegans Hypothetical
           protein F13D12.9 protein.
          Length = 452

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 9/26 (34%), Positives = 17/26 (65%)
 Frame = +3

Query: 372 MFKIYVDREEFYVKTMFETIKPKKDL 449
           MFK+++D+   Y   +F+ +KP  D+
Sbjct: 187 MFKLFLDKSMTYSSALFDEVKPVTDV 212


>AL033535-4|CAA22134.2|  452|Caenorhabditis elegans Hypothetical
           protein F13D12.9 protein.
          Length = 452

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 9/26 (34%), Positives = 17/26 (65%)
 Frame = +3

Query: 372 MFKIYVDREEFYVKTMFETIKPKKDL 449
           MFK+++D+   Y   +F+ +KP  D+
Sbjct: 187 MFKLFLDKSMTYSSALFDEVKPVTDV 212


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,267,524
Number of Sequences: 27780
Number of extensions: 337281
Number of successful extensions: 777
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 733
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 777
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1708383636
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -