Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20170
         (625 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    21   7.4  
AY526236-1|AAS20469.1|   85|Apis mellifera epoxide hydrolase pro...    21   9.8  

>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = -2

Query: 468 MVVSFIKLYMVLCSKMLWTTHILL*SP*IFTY 373
           MV+  ++LY+        T  IL+ +P IF Y
Sbjct: 476 MVIDRLQLYIFFLVTTAGTIGILMDAPHIFEY 507


>AY526236-1|AAS20469.1|   85|Apis mellifera epoxide hydrolase
           protein.
          Length = 85

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 380 KIQGDHNNMC 409
           KI G HNNMC
Sbjct: 20  KIIGLHNNMC 29


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 158,922
Number of Sequences: 438
Number of extensions: 3541
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18582456
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)