SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20081
         (635 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    25   0.47 
AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase pro...    23   3.3  

>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
           protein.
          Length = 1308

 Score = 25.4 bits (53), Expect = 0.47
 Identities = 9/17 (52%), Positives = 15/17 (88%)
 Frame = -1

Query: 194 SPAAMTLSIDSGALNTM 144
           SPA  ++S+DSG++NT+
Sbjct: 555 SPAIESISVDSGSINTV 571


>AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase
           protein.
          Length = 588

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 13/48 (27%), Positives = 19/48 (39%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           W DFV   + E   DEI      + ++      ++   N    F FIT
Sbjct: 278 WRDFVDNYAEENKRDEIVLLTEAYSSLENTLKYYEVGSNVPFNFKFIT 325


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 150,034
Number of Sequences: 438
Number of extensions: 3051
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19071468
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -