SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20080
         (709 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alp...    22   5.0  
AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor 1-a...    22   6.6  
AF134816-1|AAD40232.1|   50|Apis mellifera unknown protein.            22   6.6  
AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1al...    22   6.6  
AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    21   8.7  

>X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alpha
           protein.
          Length = 461

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = +3

Query: 255 WIQDCWGGSRESGCCSYVIHWECLSCQYYCT 347
           W+ D     RE G    +  W+  + +YY T
Sbjct: 58  WVLDKLKAERERGITIDIALWKFETAKYYVT 88


>AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor
           1-alpha protein.
          Length = 274

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = +3

Query: 255 WIQDCWGGSRESGCCSYVIHWECLSCQYYCT 347
           W+ D     RE G    +  W+  + +YY T
Sbjct: 1   WVLDKLKAERERGITIDIALWKFETSKYYVT 31


>AF134816-1|AAD40232.1|   50|Apis mellifera unknown protein.
          Length = 50

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 7/17 (41%), Positives = 11/17 (64%)
 Frame = +2

Query: 83  YSRNCHTRPKQHNRYIY 133
           ++ +C  +PK HN  IY
Sbjct: 23  WALDCSIKPKDHNGSIY 39


>AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1alpha
           F2 protein.
          Length = 461

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = +3

Query: 255 WIQDCWGGSRESGCCSYVIHWECLSCQYYCT 347
           W+ D     RE G    +  W+  + +YY T
Sbjct: 58  WVLDKLKAERERGITIDIALWKFETSKYYVT 88


>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 13/37 (35%), Positives = 17/37 (45%)
 Frame = -2

Query: 342 NSTGS*DIPSE*HSCSSQTPCCHPNSLESSRVNNHKP 232
           N  GS   PS  +SC SQ      +  E ++V   KP
Sbjct: 396 NRVGSTRRPSRRNSCESQMMGDEMSLRELTQVTEEKP 432


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 184,059
Number of Sequences: 438
Number of extensions: 3736
Number of successful extensions: 8
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21804885
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -