SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20075
         (715 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    24   1.6  
AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    24   1.6  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   5.0  
AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone este...    21   8.8  
AY526235-1|AAS20468.1|  169|Apis mellifera esterase protein.           21   8.8  
AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    21   8.8  
AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.           21   8.8  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 23.8 bits (49), Expect = 1.6
 Identities = 16/78 (20%), Positives = 32/78 (41%)
 Frame = +3

Query: 66   RSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRGLKACTNLRWSDFTVQPKS 245
            R+ +H  L      ++I   E       +V+    ++P LR   A        F  + + 
Sbjct: 1146 RAALHEALRGRTAQLIIVQAE---NAYPEVELDRELRPYLRTAAAILTWNEKRFWERLRY 1202

Query: 246  SVKPAGEYSVRPCGTPIV 299
            ++  AG+ S+    +P+V
Sbjct: 1203 AIPSAGDISIESKSSPLV 1220


>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 23.8 bits (49), Expect = 1.6
 Identities = 11/37 (29%), Positives = 18/37 (48%)
 Frame = +1

Query: 532 EALSTNSQLVPTEQVHEAIFMMLQLINGLKCLQARGV 642
           E L    Q+V   +    +F+    +NGL+ L  RG+
Sbjct: 372 EGLEMKGQMVHCPESDSILFVSSPFLNGLEGLTGRGL 408


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 12/44 (27%), Positives = 21/44 (47%)
 Frame = +3

Query: 513  PKSSLRRSSFDQLPTRAN*TGARSYLHDAATDQRPQVPSGARGR 644
            P+S   ++  DQL   +  T       D++ D+  + PS + GR
Sbjct: 1320 PESMRSKALIDQLCRNSRRTPVPRLAQDSSEDESYRGPSASGGR 1363


>AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone
           esterase protein.
          Length = 567

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +1

Query: 616 LKCLQARGVEEISETLSSFV 675
           ++CL+ R    I ETL++F+
Sbjct: 270 IRCLRYRPARAIVETLANFM 289


>AY526235-1|AAS20468.1|  169|Apis mellifera esterase protein.
          Length = 169

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +1

Query: 616 LKCLQARGVEEISETLSSFV 675
           ++CL+ R    I ETL++F+
Sbjct: 141 IRCLRYRPARAIVETLANFM 160


>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = +2

Query: 317 MLYKEQMASQIVCQQSVQP 373
           M+Y++Q  SQ   QQS QP
Sbjct: 202 MMYQQQQQSQAASQQS-QP 219


>AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.
          Length = 567

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +1

Query: 616 LKCLQARGVEEISETLSSFV 675
           ++CL+ R    I ETL++F+
Sbjct: 270 IRCLRYRPARAIVETLANFM 289


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 203,454
Number of Sequences: 438
Number of extensions: 4165
Number of successful extensions: 9
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22048515
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -