SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20074
         (622 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.          23   3.2  
AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    22   5.5  
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    22   5.5  
DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex det...    21   7.3  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    21   7.3  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    21   7.3  
DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex det...    21   9.7  
DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex det...    21   9.7  
DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex det...    21   9.7  
DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex det...    21   9.7  
AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly pro...    21   9.7  

>AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.
          Length = 148

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/35 (25%), Positives = 16/35 (45%)
 Frame = +3

Query: 18  GTMSASNGKIIVQIGPVVSEPIRNRQTNKSFLFII 122
           G+     G +   +   V +P+ N  T   FLF++
Sbjct: 38  GSYGPEAGNVSCSVSWEVHDPVTNSDTYIGFLFVL 72


>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 10/41 (24%), Positives = 18/41 (43%)
 Frame = +2

Query: 347 SKFC*VQLYIYMFVSLLCLSYASGRGLVHSTKVLQKCMTVA 469
           SKF    +Y    + L  +    G G  H T++   C+ ++
Sbjct: 705 SKFIGFTMYTTCIIWLAFVPIYFGTGNAHETQITTLCVAIS 745


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 10/41 (24%), Positives = 18/41 (43%)
 Frame = +2

Query: 347 SKFC*VQLYIYMFVSLLCLSYASGRGLVHSTKVLQKCMTVA 469
           SKF    +Y    + L  +    G G  H T++   C+ ++
Sbjct: 795 SKFIGFTMYTTCIIWLAFVPIYFGTGNAHETQITTLCVAIS 835


>DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 7.3
 Identities = 7/16 (43%), Positives = 9/16 (56%)
 Frame = +3

Query: 351 NFVKFNYTYTCLSVYY 398
           N  K+NY   C  +YY
Sbjct: 94  NNYKYNYNNNCKKLYY 109


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.4 bits (43), Expect = 7.3
 Identities = 7/21 (33%), Positives = 13/21 (61%)
 Frame = +3

Query: 375 YTCLSVYYVYLMRVDEDLCTV 437
           ++CL  + + L+ +D   CTV
Sbjct: 376 WSCLFFFMLILIGLDSQFCTV 396


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.4 bits (43), Expect = 7.3
 Identities = 7/21 (33%), Positives = 13/21 (61%)
 Frame = +3

Query: 375 YTCLSVYYVYLMRVDEDLCTV 437
           ++CL  + + L+ +D   CTV
Sbjct: 429 WSCLFFFMLILIGLDSQFCTV 449


>DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex
           determiner protein.
          Length = 186

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 8/24 (33%), Positives = 10/24 (41%)
 Frame = +3

Query: 327 HFKNECVQNFVKFNYTYTCLSVYY 398
           H  N    N+   NY   C  +YY
Sbjct: 91  HNNNNYKYNYNNNNYNNNCKKLYY 114


>DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 8/24 (33%), Positives = 10/24 (41%)
 Frame = +3

Query: 327 HFKNECVQNFVKFNYTYTCLSVYY 398
           H  N    N+   NY   C  +YY
Sbjct: 91  HNNNNYKYNYNNNNYNNNCKKLYY 114


>DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 8/24 (33%), Positives = 10/24 (41%)
 Frame = +3

Query: 327 HFKNECVQNFVKFNYTYTCLSVYY 398
           H  N    N+   NY   C  +YY
Sbjct: 91  HNNNNYKYNYNNNNYNNNCKKLYY 114


>DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 8/24 (33%), Positives = 10/24 (41%)
 Frame = +3

Query: 327 HFKNECVQNFVKFNYTYTCLSVYY 398
           H  N    N+   NY   C  +YY
Sbjct: 91  HNNNNYKYNYNNNNYNNNCKKLYY 114


>AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly
           protein 8 protein.
          Length = 416

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 508 YINTDSFVYYQYR 470
           Y+NT+ FV  QY+
Sbjct: 275 YVNTEQFVKSQYQ 287


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,107
Number of Sequences: 438
Number of extensions: 3356
Number of successful extensions: 12
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18460203
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -