SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20072
         (691 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    25   0.90 
AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.             25   0.90 
EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.          24   1.2  
EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.      24   1.2  
L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        23   2.7  
Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein RJP...    22   6.3  
AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    22   6.3  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   8.4  

>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 24.6 bits (51), Expect = 0.90
 Identities = 16/68 (23%), Positives = 29/68 (42%)
 Frame = -3

Query: 644 PQGLGSWRISQLSQAPKIDRIYSHSCTSRSSRWRNSIPFPIQFSSSLEFVVRQSRNAQLT 465
           P+G+   R S      K  R ++H   ++ +R    +PF +  S   +F  R +      
Sbjct: 226 PKGINGRRASLFCGLQKYTRSFAHQSINKEARSNLYLPFHLTLSFR-DFRDRTTEQQHKA 284

Query: 464 VFLEHSTQ 441
           +FL  + Q
Sbjct: 285 MFLVVTAQ 292


>AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.
          Length = 289

 Score = 24.6 bits (51), Expect = 0.90
 Identities = 16/68 (23%), Positives = 29/68 (42%)
 Frame = -3

Query: 644 PQGLGSWRISQLSQAPKIDRIYSHSCTSRSSRWRNSIPFPIQFSSSLEFVVRQSRNAQLT 465
           P+G+   R S      K  R ++H   ++ +R    +PF +  S   +F  R +      
Sbjct: 221 PKGINGRRASLFCGLQKYTRSFAHQSINKEARSNLYLPFHLTLSFR-DFRDRTTEQQHKA 279

Query: 464 VFLEHSTQ 441
           +FL  + Q
Sbjct: 280 MFLVVTAQ 287


>EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.
          Length = 684

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
 Frame = +2

Query: 554 KICSYKNESKCDLSLEPEITEIFSTS-QDP 640
           KI  Y  E+     + P   EIFSTS +DP
Sbjct: 387 KILGYNLEAASKYQIVPSALEIFSTSMKDP 416


>EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.
          Length = 684

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
 Frame = +2

Query: 554 KICSYKNESKCDLSLEPEITEIFSTS-QDP 640
           KI  Y  E+     + P   EIFSTS +DP
Sbjct: 387 KILGYNLEAASKYQIVPSALEIFSTSMKDP 416


>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = -2

Query: 684 PAALCHSTQACFNSSGSWLVENISVI 607
           P+A C +T    N   SWL E+  V+
Sbjct: 229 PSAQCEATTMQENDKMSWLFESEDVL 254


>Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein
           RJP57-2 protein.
          Length = 464

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 9/28 (32%), Positives = 18/28 (64%)
 Frame = -2

Query: 675 LCHSTQACFNSSGSWLVENISVISGSKD 592
           L ++T +C+N   S   +NI V++ ++D
Sbjct: 320 LANNTLSCWNEHQSLDRQNIDVVARNED 347


>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 7/17 (41%), Positives = 9/17 (52%)
 Frame = -2

Query: 660 QACFNSSGSWLVENISV 610
           Q CF   GSW  + I +
Sbjct: 157 QTCFMKFGSWTYDGIQI 173


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 5/13 (38%), Positives = 12/13 (92%)
 Frame = -3

Query: 290  PVLPQAGRFVQMS 252
            P++P+A RF++++
Sbjct: 1461 PIIPEAARFIEVA 1473


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 187,830
Number of Sequences: 438
Number of extensions: 3792
Number of successful extensions: 12
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21073995
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -