SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20065
         (649 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              30   0.017
AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    24   1.1  
DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    23   1.9  
S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating...    21   7.8  
AY217747-1|AAP45005.1|  246|Apis mellifera short-chain dehydroge...    21   7.8  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    21   7.8  

>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 30.3 bits (65), Expect = 0.017
 Identities = 11/23 (47%), Positives = 17/23 (73%)
 Frame = +3

Query: 174 SEDFRQKIHGQVRSCVQTATRGS 242
           +ED+RQ++H QV SC+  +  GS
Sbjct: 67  AEDYRQEVHAQVYSCLARSPAGS 89


>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = +1

Query: 520 FNVKDKRSFVYMTCKSY*VQIKVDVKKLVQFT 615
           FNV D  +     CK Y + +  ++ K + FT
Sbjct: 446 FNVTDGETTKTFCCKGYCMDLLKELSKTINFT 477


>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%)
 Frame = -1

Query: 265 SVQCVPSLLPRVAVCTQD-RTWP 200
           SV CVPS +  VA C  D  +WP
Sbjct: 156 SVSCVPS-VKHVAKCATDFSSWP 177



 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/20 (35%), Positives = 12/20 (60%)
 Frame = +1

Query: 43  AGRITCTADFKHLARKLTHF 102
           +G ++C    KH+A+  T F
Sbjct: 154 SGSVSCVPSVKHVAKCATDF 173


>S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating
           peptide protein.
          Length = 50

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/15 (46%), Positives = 12/15 (80%), Gaps = 1/15 (6%)
 Frame = +2

Query: 290 SVSCDSKRHIVR-HI 331
           S+ C+ KRH+++ HI
Sbjct: 27  SIKCNCKRHVIKPHI 41


>AY217747-1|AAP45005.1|  246|Apis mellifera short-chain
           dehydrogenase/reductase protein.
          Length = 246

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -2

Query: 585 FDLHLITLTCHIYE 544
           FD++L+ LTC I E
Sbjct: 112 FDINLLGLTCMIQE 125


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 8/23 (34%), Positives = 16/23 (69%)
 Frame = +1

Query: 304 QQTSHRSTHLASARCESTILTSF 372
           Q+TS+  ++L++ R  + + TSF
Sbjct: 5   QETSNEDSYLSAGRPSNLLRTSF 27


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,820
Number of Sequences: 438
Number of extensions: 3863
Number of successful extensions: 12
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19560480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -