SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20063
         (681 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine beta-sy...    29   0.054
DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    23   2.0  
AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    22   4.7  
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    22   6.2  
AF213012-1|AAG43568.1|  492|Apis mellifera acetylcholinesterase ...    21   8.2  
AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    21   8.2  
AB181702-1|BAE06051.1|  628|Apis mellifera acetylcholinesterase ...    21   8.2  

>AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine
           beta-synthase protein.
          Length = 504

 Score = 28.7 bits (61), Expect = 0.054
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = -2

Query: 395 SLLRGDTVDCESALNIID*TKQFISLLN*DNIHKSSRIS-RVSPNFPITFMRRCFTIFRT 219
           SLL+ +TV C+ A++++      + +++ DNIH    IS     ++ I+ + +C T F  
Sbjct: 381 SLLKENTVTCQEAMHMLKNADSQLLVISDDNIHIKGVISLNKLTSYVISGIVKC-TDFVD 439

Query: 218 SFPVKAYFR 192
              VK Y +
Sbjct: 440 KAMVKQYVK 448


>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 17/63 (26%), Positives = 30/63 (47%)
 Frame = -2

Query: 506 DFDKWVWIADGAAIMRYQVRNILRSGRHTLDFTQLVLSLLRGDTVDCESALNIID*TKQF 327
           D    +WI  G  +M +    + R G+  +  T L+ ++L    + CE  +NI    K +
Sbjct: 57  DVHVMIWIGFGF-LMTF----LRRYGQSAVGLTFLLGAILVQVAIICEGVMNIQKDNKSY 111

Query: 326 ISL 318
           +SL
Sbjct: 112 LSL 114


>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = -2

Query: 200 YFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLS 99
           Y R  +R  T  +H ++    +DG+G Y   S S
Sbjct: 83  YNRMDMRNATYYQHQQDHGSGMDGMGGYRSASPS 116


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 10/33 (30%), Positives = 16/33 (48%)
 Frame = +2

Query: 479 PLSRPTYQSQDSIQLDIATTKIMDFIKFESGNL 577
           PLS PTY   + ++L       +  + F+ G L
Sbjct: 256 PLSHPTYDWFEKLELKWFAVPAVSGMVFDCGGL 288


>AF213012-1|AAG43568.1|  492|Apis mellifera acetylcholinesterase
           protein.
          Length = 492

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 11/39 (28%), Positives = 18/39 (46%)
 Frame = +3

Query: 564 SPGTCV*SREAVTWGVWAPSCSRERHPGSSTLCTSRTPR 680
           +P T + S + +   +W P   R RH G  +   +  PR
Sbjct: 117 NPNTNI-SEDCLYLNIWVPQKYRLRHKGDGSPGGNGGPR 154


>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = +1

Query: 460 RMMAAPSAIQTHLSKSRFHPVRHCNYED 543
           R++  PSA +T LSK  +  + H    D
Sbjct: 233 RLLDEPSANRTDLSKDDYESLVHLYTRD 260



 Score = 21.4 bits (43), Expect = 8.2
 Identities = 10/36 (27%), Positives = 20/36 (55%)
 Frame = +3

Query: 78  RSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPE 185
           +S++ DV ++WR +  E  NR+    R++    + E
Sbjct: 261 QSETYDVLRSWRNLMDEHSNRTNSDPRMILTEAYTE 296


>AB181702-1|BAE06051.1|  628|Apis mellifera acetylcholinesterase
           protein.
          Length = 628

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 11/39 (28%), Positives = 18/39 (46%)
 Frame = +3

Query: 564 SPGTCV*SREAVTWGVWAPSCSRERHPGSSTLCTSRTPR 680
           +P T + S + +   +W P   R RH G  +   +  PR
Sbjct: 117 NPNTNI-SEDCLYLNIWVPQKYRLRHKGDGSPGGNGGPR 154


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 208,393
Number of Sequences: 438
Number of extensions: 4769
Number of successful extensions: 12
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20708550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -