SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20060
         (530 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    24   0.84 
DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex det...    22   3.4  
DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex det...    22   3.4  
DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex det...    22   3.4  
DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex det...    22   3.4  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   5.9  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    21   5.9  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    21   5.9  
AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    21   7.9  

>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
            protein.
          Length = 1124

 Score = 24.2 bits (50), Expect = 0.84
 Identities = 10/17 (58%), Positives = 10/17 (58%)
 Frame = -2

Query: 466  DGFLSSTDDVGSFRGSW 416
            DG  SS  D GS  GSW
Sbjct: 1064 DGITSSGSDSGSSNGSW 1080


>DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex
           determiner protein.
          Length = 186

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 10/33 (30%), Positives = 16/33 (48%)
 Frame = +2

Query: 143 RHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSR 241
           R Q+ + +   Y      WK+RSR + +   SR
Sbjct: 45  REQKSYKNENSYRKYRETWKERSRDRTERERSR 77


>DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 10/33 (30%), Positives = 16/33 (48%)
 Frame = +2

Query: 143 RHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSR 241
           R Q+ + +   Y      WK+RSR + +   SR
Sbjct: 45  REQKSYKNENSYRKYRETWKERSRDRTERERSR 77


>DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 10/33 (30%), Positives = 16/33 (48%)
 Frame = +2

Query: 143 RHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSR 241
           R Q+ + +   Y      WK+RSR + +   SR
Sbjct: 45  REQKSYKNENSYRKYRETWKERSRDRTERERSR 77


>DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 10/33 (30%), Positives = 16/33 (48%)
 Frame = +2

Query: 143 RHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSR 241
           R Q+ + +   Y      WK+RSR + +   SR
Sbjct: 45  REQKSYKNENSYRKYRETWKERSRDRTERERSR 77


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.4 bits (43), Expect = 5.9
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = +2

Query: 152 RQWCSSKGYATQSIPWKDRSRV 217
           R  C   GY  +SI W+  +RV
Sbjct: 509 RVTCPVAGYPIESIVWERDTRV 530


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.4 bits (43), Expect = 5.9
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -2

Query: 61  PWCRXGNPW 35
           PW   GNPW
Sbjct: 135 PWRTCGNPW 143


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.4 bits (43), Expect = 5.9
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -2

Query: 61  PWCRXGNPW 35
           PW   GNPW
Sbjct: 188 PWRTCGNPW 196


>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 9/48 (18%), Positives = 18/48 (37%)
 Frame = -1

Query: 215 HATCLSMVYFVWHTLLNCTIASDVYNVSNFVHFHVRGERNSSMCAELR 72
           H   L  V      +  CT+  + +     +  H++   +SS+    R
Sbjct: 245 HVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIKTHSDSSVVGSPR 292


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 145,615
Number of Sequences: 438
Number of extensions: 2816
Number of successful extensions: 10
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14968302
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -