SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20058
         (614 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.     24   1.0  
DQ855486-1|ABH88173.1|  104|Apis mellifera chemosensory protein ...    24   1.4  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   2.4  
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    23   3.1  

>AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.
          Length = 602

 Score = 24.2 bits (50), Expect = 1.0
 Identities = 9/26 (34%), Positives = 15/26 (57%)
 Frame = +3

Query: 408 VNKKCSTHLSVLVHRVFNVVIPQPTE 485
           V  +   H ++L    FN++I +PTE
Sbjct: 352 VQAEAEKHAAMLYQYNFNIIISEPTE 377


>DQ855486-1|ABH88173.1|  104|Apis mellifera chemosensory protein 5
           protein.
          Length = 104

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +1

Query: 283 IKILVYFRMLALYAMIMRIYISKFKRITSY 372
           IKIL++F +LAL  +  +  ISKF +   Y
Sbjct: 3   IKILLFFTILALINVKAQDDISKFLKDRPY 32


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 8/16 (50%), Positives = 12/16 (75%)
 Frame = -2

Query: 61  LNIHANKIIHFQRFAF 14
           LN+  NK+ H +R+AF
Sbjct: 507 LNLARNKVQHVERYAF 522


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 10/26 (38%), Positives = 13/26 (50%)
 Frame = +2

Query: 461 CGHTTANRRAWRQVDRSSVKEGQEVT 538
           C   TAN R W      ++K+G  VT
Sbjct: 498 CIFRTANGRGWGVKTMKTIKKGSFVT 523


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 156,748
Number of Sequences: 438
Number of extensions: 3052
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18215697
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -