SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20057
         (573 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U26026-1|AAA69069.1|  377|Apis mellifera long-wavelength rhodops...    23   2.8  
AY703752-1|AAU12748.1|  152|Apis mellifera long-wavelength rhodo...    23   2.8  
AF091732-1|AAD02869.2|  154|Apis mellifera long-wavelength rhodo...    23   2.8  
AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phospha...    23   2.8  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    22   3.8  
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    22   3.8  

>U26026-1|AAA69069.1|  377|Apis mellifera long-wavelength rhodopsin
           protein.
          Length = 377

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 8/27 (29%), Positives = 16/27 (59%)
 Frame = -2

Query: 152 WSMSSCSLDKLSTTFKGLSSASGTLSG 72
           W+M+  + D+ +   KGLS    +++G
Sbjct: 141 WTMTMIAFDRYNVIVKGLSGKPLSING 167


>AY703752-1|AAU12748.1|  152|Apis mellifera long-wavelength
           rhodopsin protein.
          Length = 152

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 8/27 (29%), Positives = 16/27 (59%)
 Frame = -2

Query: 152 WSMSSCSLDKLSTTFKGLSSASGTLSG 72
           W+M+  + D+ +   KGLS    +++G
Sbjct: 107 WTMTMIAFDRYNVIVKGLSGKPLSING 133


>AF091732-1|AAD02869.2|  154|Apis mellifera long-wavelength
           rhodopsin protein.
          Length = 154

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 8/27 (29%), Positives = 16/27 (59%)
 Frame = -2

Query: 152 WSMSSCSLDKLSTTFKGLSSASGTLSG 72
           W+M+  + D+ +   KGLS    +++G
Sbjct: 17  WTMTMIAFDRYNVIVKGLSGKPLSING 43


>AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phosphate
           dehydrogenase protein.
          Length = 363

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 8/31 (25%), Positives = 17/31 (54%)
 Frame = +1

Query: 94  EDKPLNVVDNLSSEQELIDQANTIKDIDNSL 186
           E  P+ +++NL +  E ID+    ++   S+
Sbjct: 333 ETMPMELIENLRNHPEYIDETRNYQECKCSI 363


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 11/35 (31%), Positives = 18/35 (51%)
 Frame = +3

Query: 264 LENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQN 368
           +E  E  DE + I+ P+V   +  PP  +  ET +
Sbjct: 171 VEENETYDEFDTIRIPIVRSLSKSPPNDEGIETDS 205


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +1

Query: 196 KKEVIDIPVKVIVEEIKPSLRVI 264
           KKE+ DI  +V VEEI    +V+
Sbjct: 570 KKEIYDILPEVDVEEILGEAKVL 592


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 134,175
Number of Sequences: 438
Number of extensions: 2640
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16504155
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -