SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20054
         (677 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    27   0.16 
Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein RJP...    24   1.5  
AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.              23   2.7  
AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta...    23   2.7  
AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    23   2.7  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    23   3.5  
DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex det...    22   4.7  
AB194707-1|BAD69622.1|  247|Apis mellifera heme oxygenase protein.     22   6.2  
AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    22   6.2  
DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    21   8.2  

>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 27.1 bits (57), Expect = 0.16
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 9/49 (18%)
 Frame = +1

Query: 271 VHEVDLEWRHGRGGHVTLQ--DEDVTTKT-------LNGWRKLNTLAHY 390
           V +++LEW  G  G       D D T K+        +GWRKL  + H+
Sbjct: 180 VPQINLEWGEGSSGDDLSSEWDSDYTDKSNEKKIPKSSGWRKLRNIVHW 228


>Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein
           RJP57-2 protein.
          Length = 464

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 12/44 (27%), Positives = 21/44 (47%)
 Frame = +2

Query: 74  EARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVLDCDSI 205
           E  Y ++ E L+K +     V    VQD FD ++  K +  + +
Sbjct: 272 ENLYYVNTESLMKSENQGNDVQYERVQDVFDSQLTVKAVSKNGV 315


>AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.
          Length = 145

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 8/22 (36%), Positives = 14/22 (63%)
 Frame = +2

Query: 146 IVQDEFDEKVQCKVLDCDSISQ 211
           +++ +  E V+CK + C  ISQ
Sbjct: 124 VMEIKIREPVECKCIKCGDISQ 145


>AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta
           protein precursor protein.
          Length = 145

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 8/22 (36%), Positives = 14/22 (63%)
 Frame = +2

Query: 146 IVQDEFDEKVQCKVLDCDSISQ 211
           +++ +  E V+CK + C  ISQ
Sbjct: 124 VMEIKIREPVECKCIKCGDISQ 145


>AF388659-2|AAK71994.1|  463|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
          Length = 463

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +1

Query: 337 VTTKTLNGWRKLNTLAHY 390
           V  K  +GWRKL  + H+
Sbjct: 126 VGRKKSSGWRKLRNIVHW 143


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 7/20 (35%), Positives = 12/20 (60%)
 Frame = +1

Query: 331 EDVTTKTLNGWRKLNTLAHY 390
           + V +   +GWRKL  + H+
Sbjct: 443 QPVKSSKSSGWRKLRNIVHW 462


>DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 8/26 (30%), Positives = 16/26 (61%)
 Frame = +3

Query: 513 YNSDITDQNVHYYHLVKPIEYQHIVN 590
           YN++  + N +Y    K ++Y +I+N
Sbjct: 94  YNNNYNNYNNNYNTNYKKLQYYNIIN 119


>AB194707-1|BAD69622.1|  247|Apis mellifera heme oxygenase protein.
          Length = 247

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 15/45 (33%), Positives = 19/45 (42%)
 Frame = +1

Query: 220 EDTRCSLQKYSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTL 354
           +DT   L  +    R    EVDLE+  G+     L   D  TK L
Sbjct: 64  KDTEIGLFLHEELRRTEAFEVDLEFYLGKEWKKNLNLRDSVTKYL 108


>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +1

Query: 331 EDVTTKTLNGWRKLNTLAHYGVKESAIMSLIS 426
           ED++   +NG+    T++  GV+ S+  + I+
Sbjct: 240 EDLSGDRINGFTVAQTISRNGVRLSSARAFIT 271


>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 8/22 (36%), Positives = 14/22 (63%)
 Frame = -1

Query: 422 INDIMADSLTP*WANVFNFRHP 357
           +N+I+A S    +  +F+F HP
Sbjct: 279 VNNILAASACSLFVVIFHFAHP 300


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 172,803
Number of Sequences: 438
Number of extensions: 3269
Number of successful extensions: 12
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20586735
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -