SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20051
         (781 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alp...    33   0.004
AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1al...    33   0.004
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    29   0.037
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    25   0.60 
EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor 1-a...    24   1.4  
AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor 1-a...    24   1.4  
AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    23   3.2  
DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex det...    23   4.2  
DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex det...    23   4.2  
DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex det...    23   4.2  
AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone este...    23   4.2  
AY526235-1|AAS20468.1|  169|Apis mellifera esterase protein.           23   4.2  
AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.           23   4.2  
DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    22   5.6  
AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.          22   5.6  
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    22   7.4  
AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor pr...    22   7.4  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   7.4  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    22   7.4  
DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex det...    21   9.7  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   9.7  

>X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alpha
           protein.
          Length = 461

 Score = 32.7 bits (71), Expect = 0.004
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32



 Score = 24.2 bits (50), Expect = 1.4
 Identities = 9/29 (31%), Positives = 15/29 (51%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + + +ID+PGH DF   +       D A+
Sbjct: 85  YYVTIIDAPGHRDFIKNMITGTSQADCAV 113


>AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1alpha
           F2 protein.
          Length = 461

 Score = 32.7 bits (71), Expect = 0.004
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32



 Score = 24.2 bits (50), Expect = 1.4
 Identities = 9/29 (31%), Positives = 15/29 (51%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + + +ID+PGH DF   +       D A+
Sbjct: 85  YYVTIIDAPGHRDFIKNMITGTSQADCAV 113


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 29.5 bits (63), Expect = 0.037
 Identities = 10/18 (55%), Positives = 16/18 (88%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSL 174
           ++++ HVDHGK+TL D+L
Sbjct: 148 VTIMGHVDHGKTTLLDAL 165



 Score = 24.2 bits (50), Expect = 1.4
 Identities = 10/29 (34%), Positives = 14/29 (48%)
 Frame = +3

Query: 351 EKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           E G  +  +D+PGH  F S       +TD
Sbjct: 190 ESGERVTFLDTPGHAAFISMRHRGAHITD 218


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 25.4 bits (53), Expect = 0.60
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSL 174
           N+  I HV HGKST+  ++
Sbjct: 44  NIGTIGHVAHGKSTIVKAI 62


>EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor
           1-alpha protein.
          Length = 172

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 9/29 (31%), Positives = 15/29 (51%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + + +ID+PGH DF   +       D A+
Sbjct: 12  YYVTIIDAPGHRDFIKNMITGTSQADCAV 40


>AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor
           1-alpha protein.
          Length = 274

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 9/29 (31%), Positives = 15/29 (51%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + + +ID+PGH DF   +       D A+
Sbjct: 28  YYVTIIDAPGHRDFIKNMITGTSQADCAV 56


>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
            receptor 1 protein.
          Length = 953

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 12/45 (26%), Positives = 23/45 (51%)
 Frame = -1

Query: 571  LELKKSTVHFVHEQNRLDALGIA*RSTVSVCTHTPDTQSTTTRAP 437
            +E +K+    +  Q R+ + G+   +TVS+   T    + T R+P
Sbjct: 872  IEKRKTLRASIAAQRRIQSNGLNDPTTVSLAVDTVARSNVTPRSP 916



 Score = 21.4 bits (43), Expect = 9.7
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = +3

Query: 255 CITIKSTAISMFF 293
           C T+K +A+ M+F
Sbjct: 688 CATVKGSAVDMYF 700


>DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 12/41 (29%), Positives = 18/41 (43%)
 Frame = +2

Query: 164 RTRWFPRPVSLLVREPERPVSLTRVRTNKTVHHH*IYGHLY 286
           R  W  R      RE  R   +    +NKT+H++  Y + Y
Sbjct: 60  RETWKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNY 100


>DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 12/41 (29%), Positives = 18/41 (43%)
 Frame = +2

Query: 164 RTRWFPRPVSLLVREPERPVSLTRVRTNKTVHHH*IYGHLY 286
           R  W  R      RE  R   +    +NKT+H++  Y + Y
Sbjct: 60  RETWKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNY 100


>DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 12/41 (29%), Positives = 18/41 (43%)
 Frame = +2

Query: 164 RTRWFPRPVSLLVREPERPVSLTRVRTNKTVHHH*IYGHLY 286
           R  W  R      RE  R   +    +NKT+H++  Y + Y
Sbjct: 60  RETWKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNY 100


>AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone
           esterase protein.
          Length = 567

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 9/25 (36%), Positives = 15/25 (60%)
 Frame = +3

Query: 702 VSGLVFMGGLSPSNNSLRCMRQIQD 776
           +S  +F GG+S S  +L C  Q ++
Sbjct: 223 LSAGLFQGGISISGTALNCWTQTEN 247


>AY526235-1|AAS20468.1|  169|Apis mellifera esterase protein.
          Length = 169

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 9/25 (36%), Positives = 15/25 (60%)
 Frame = +3

Query: 702 VSGLVFMGGLSPSNNSLRCMRQIQD 776
           +S  +F GG+S S  +L C  Q ++
Sbjct: 94  LSAGLFQGGISISGTALNCWTQTEN 118


>AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.
          Length = 567

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 9/25 (36%), Positives = 15/25 (60%)
 Frame = +3

Query: 702 VSGLVFMGGLSPSNNSLRCMRQIQD 776
           +S  +F GG+S S  +L C  Q ++
Sbjct: 223 LSAGLFQGGISISGTALNCWTQTEN 247


>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 6/14 (42%), Positives = 10/14 (71%)
 Frame = -2

Query: 99  VHHPTDLVYREIHH 58
           +HHP   + R++HH
Sbjct: 400 LHHPNCKINRKVHH 413


>AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.
          Length = 400

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 13/44 (29%), Positives = 18/44 (40%)
 Frame = -3

Query: 500 TQYCFSLYTHTRHTVNNHKGSISDTECSCYFRREINVSR*VNQV 369
           T  C S Y  +RH   N   +  +  CS    RE    R  +Q+
Sbjct: 227 TSSCHSRYEDSRHEDRNSYRNDGERSCSRDRSREYKKDRRYDQL 270


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +3

Query: 279 ISMFFELEEKDLVFITNPDQREKSEKGFLI 368
           ++MF+     D+  I+N +Q + S  GF I
Sbjct: 527 LNMFYNNFNSDIKSISNNEQVKVSALGFFI 556


>AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor
           protein.
          Length = 501

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
 Frame = -1

Query: 463 TQSTTTRAP-SVTRSAAVTSEEKSTC 389
           + STTT +P + T+S  V +   STC
Sbjct: 324 SSSTTTTSPMTSTKSTIVRNHLNSTC 349


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +1

Query: 193 IAGARAGETRFTDTRKDEQDRASPLNLRPSLCSSSLKRKI*YSS 324
           + G  AG+   T +    +D  SP  L P+L S+++ +   YSS
Sbjct: 631 VCGVAAGDPPLTISWL--KDGQSPFPLPPNLASANISQLDPYSS 672


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +3

Query: 279 ISMFFELEEKDLVFITNPDQREKSEKGFLI 368
           ++MF+     D+  I+N +Q + S  GF I
Sbjct: 527 LNMFYNNFNSDIKSISNNEQVKVSALGFFI 556


>DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex
           determiner protein.
          Length = 186

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 11/41 (26%), Positives = 18/41 (43%)
 Frame = +2

Query: 164 RTRWFPRPVSLLVREPERPVSLTRVRTNKTVHHH*IYGHLY 286
           R  W  R      RE  R   +    +N+T+H++  Y + Y
Sbjct: 60  RETWKERSRDRTERERSREPKIISSLSNRTIHNNNNYKYNY 100


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 8/15 (53%), Positives = 11/15 (73%)
 Frame = -3

Query: 611  QYAGTSGIVLQLQVG 567
            +Y   SG+V+QLQ G
Sbjct: 1549 EYGAVSGLVVQLQRG 1563


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 223,426
Number of Sequences: 438
Number of extensions: 5199
Number of successful extensions: 32
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 28
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24518154
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -