SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20050
         (647 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1al...   179   2e-47
AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor 1-a...   177   6e-47
X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alp...   175   2e-46
EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor 1-a...   165   2e-43
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    33   0.002
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    24   1.1  
DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    23   2.5  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    23   2.5  
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    23   3.4  

>AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1alpha
           F2 protein.
          Length = 461

 Score =  179 bits (436), Expect = 2e-47
 Identities = 90/119 (75%), Positives = 98/119 (82%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 5e-36
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 91.9 bits (218), Expect = 5e-21
 Identities = 41/42 (97%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYSE RFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG
Sbjct: 157 STEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 198


>AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor
           1-alpha protein.
          Length = 274

 Score =  177 bits (432), Expect = 6e-47
 Identities = 86/95 (90%), Positives = 88/95 (92%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG
Sbjct: 3   LDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 62

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           TGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 63  TGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 97



 Score = 91.9 bits (218), Expect = 5e-21
 Identities = 41/42 (97%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYSE RFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG
Sbjct: 100 STEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 141



 Score = 23.4 bits (48), Expect = 1.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +2

Query: 227 WVLDKLKAE 253
           WVLDKLKAE
Sbjct: 1   WVLDKLKAE 9


>X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alpha
           protein.
          Length = 461

 Score =  175 bits (427), Expect = 2e-46
 Identities = 88/119 (73%), Positives = 97/119 (81%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFET+KYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGIGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 5e-36
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 84.6 bits (200), Expect = 7e-19
 Identities = 37/41 (90%), Positives = 39/41 (95%)
 Frame = +2

Query: 524 TEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           T+PPYSE RFEEIKKEVSSYIKKIGYN A+VAFVPISGWHG
Sbjct: 158 TDPPYSEARFEEIKKEVSSYIKKIGYNTASVAFVPISGWHG 198


>EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor
           1-alpha protein.
          Length = 172

 Score =  165 bits (402), Expect = 2e-43
 Identities = 79/81 (97%), Positives = 79/81 (97%)
 Frame = +1

Query: 274 DIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 453
           DIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT
Sbjct: 1   DIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 60

Query: 454 REHALLAFTLGVKQLIVGETK 516
           REHALLAFTLGVKQLIVG  K
Sbjct: 61  REHALLAFTLGVKQLIVGVNK 81



 Score = 91.9 bits (218), Expect = 5e-21
 Identities = 41/42 (97%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYSE RFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG
Sbjct: 84  STEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 125


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 33.1 bits (72), Expect = 0.002
 Identities = 16/35 (45%), Positives = 18/35 (51%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           VT +D PGH  FI     G    D  VL+VAA  G
Sbjct: 195 VTFLDTPGHAAFISMRHRGAHITDIVVLVVAADDG 229



 Score = 25.4 bits (53), Expect = 0.48
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKST 121
           K H  + ++GHVD GK+T
Sbjct: 143 KRHPIVTIMGHVDHGKTT 160


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 11/15 (73%), Positives = 11/15 (73%)
 Frame = +2

Query: 77  INIVVIGHVDSGKST 121
           INI  IGHV  GKST
Sbjct: 43  INIGTIGHVAHGKST 57


>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 69  FSLPIFG*SRITNCV*Y 19
           FSLPIFG   I +C+ Y
Sbjct: 57  FSLPIFGTRWIFSCIGY 73


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = +1

Query: 298 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 399
           T KYY    D P +  FIKN+   ++ +D   LI
Sbjct: 294 TMKYYDYGADFPFNFAFIKNVSRDSNSSDFKKLI 327


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +1

Query: 298 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 399
           T KYY    D P +  FIKN+   ++ +D   L+
Sbjct: 294 TMKYYDYGADFPFNFAFIKNVSRDSNSSDFKKLV 327


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 183,989
Number of Sequences: 438
Number of extensions: 3602
Number of successful extensions: 23
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19560480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -