SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20049
         (646 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein RJP...    24   1.1  
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    23   2.5  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    23   2.5  
AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    23   3.3  
DQ863218-1|ABI94394.1|  399|Apis mellifera tyramine receptor pro...    21   7.7  
DQ863217-1|ABI94393.1|  399|Apis mellifera tyramine receptor pro...    21   7.7  
DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    21   7.7  
AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled rec...    21   7.7  
AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl sub...    21   7.7  
AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phospha...    21   7.7  

>Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein
           RJP57-1 protein.
          Length = 544

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = -1

Query: 223 QTDHFHISND*NTNDNFCHH 164
           Q D+ +  ND N NDN  HH
Sbjct: 520 QNDNQNNQNDNNRNDNQVHH 539


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = -3

Query: 629 GVCHPKLPPRRTPPCFCHER 570
           G+   K P  R+PP F H R
Sbjct: 460 GIEEVKSPVLRSPPAFSHSR 479


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = -3

Query: 629 GVCHPKLPPRRTPPCFCHER 570
           G+   K P  R+PP F H R
Sbjct: 460 GIEEVKSPVLRSPPAFSHSR 479


>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 8/19 (42%), Positives = 14/19 (73%)
 Frame = -3

Query: 572 RASVLAERRVPVSGRREPS 516
           RAS+ A+RR+  +G  +P+
Sbjct: 879 RASIAAQRRIQSNGLNDPT 897


>DQ863218-1|ABI94394.1|  399|Apis mellifera tyramine receptor
           protein.
          Length = 399

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 6/14 (42%), Positives = 10/14 (71%)
 Frame = -1

Query: 430 FIILPHGPNCCIGD 389
           ++I+P  P+CC  D
Sbjct: 347 YVIVPFCPDCCPSD 360


>DQ863217-1|ABI94393.1|  399|Apis mellifera tyramine receptor
           protein.
          Length = 399

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 6/14 (42%), Positives = 10/14 (71%)
 Frame = -1

Query: 430 FIILPHGPNCCIGD 389
           ++I+P  P+CC  D
Sbjct: 347 YVIVPFCPDCCPSD 360


>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 7/19 (36%), Positives = 11/19 (57%)
 Frame = -3

Query: 299 PSQHFFKQSHNSYTNHTEL 243
           P   +  Q++N YT+H  L
Sbjct: 111 PKNQYKNQNNNHYTSHQHL 129


>AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled
           receptor protein.
          Length = 399

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 6/14 (42%), Positives = 10/14 (71%)
 Frame = -1

Query: 430 FIILPHGPNCCIGD 389
           ++I+P  P+CC  D
Sbjct: 347 YVIVPFCPDCCPSD 360


>AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl
           subunit protein.
          Length = 365

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 11/34 (32%), Positives = 14/34 (41%)
 Frame = +2

Query: 428 EKFRHGHANPGSGVAEADLVQASPHRAVIKKVHD 529
           E  +    NPG      D    +P + V  KVHD
Sbjct: 262 ESMKTARENPGPPGVPGDHGDHAPKQTVRFKVHD 295


>AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phosphate
           dehydrogenase protein.
          Length = 363

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 8/29 (27%), Positives = 19/29 (65%)
 Frame = +2

Query: 23  ATWSLAVQLPAHHHTSFQFKNTLYIYNEI 109
           +T +  + + A + ++F+ + T+Y+Y EI
Sbjct: 17  STIAKIIGINAANFSNFEDRVTMYVYEEI 45


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 197,502
Number of Sequences: 438
Number of extensions: 4423
Number of successful extensions: 11
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19438227
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -