SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20048
         (771 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    25   0.78 
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             24   1.4  

>AF388659-2|AAK71994.1|  463|Apis mellifera
          1D-myo-inositol-trisphosphate 3-kinaseisoform B
          protein.
          Length = 463

 Score = 25.0 bits (52), Expect = 0.78
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +3

Query: 12 LRGGGSSKPPEPALQSKP 65
          L+GGGS+ P  P L + P
Sbjct: 18 LKGGGSTTPASPTLSTPP 35


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = -3

Query: 130 LGPPRTTRPFASWIPWLLNVKFGFDCRAGSGGFDEPPPLSPRA 2
           +G  RT+ P   W P    +   + C  G    D+ PPLSP++
Sbjct: 409 IGSRRTSPPPEDWKP----LDKCYFCLDGKLPHDDQPPLSPQS 447


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 202,929
Number of Sequences: 438
Number of extensions: 4333
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24154023
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -