SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20047
         (659 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    25   0.85 
U15956-1|AAA67444.1|  129|Apis mellifera hymenoptaecin precursor...    23   3.4  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   3.4  
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    22   4.5  
X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alp...    21   7.9  

>AF388659-2|AAK71994.1|  463|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
          Length = 463

 Score = 24.6 bits (51), Expect = 0.85
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +2

Query: 479 DRYKRNNAKIIASKGKLPPPSNAASTPNT 565
           D+ K+NN + +   G   P S   STP T
Sbjct: 8   DQEKKNNVENLKGGGSTTPASPTLSTPPT 36


>U15956-1|AAA67444.1|  129|Apis mellifera hymenoptaecin precursor
           protein.
          Length = 129

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 8/20 (40%), Positives = 10/20 (50%)
 Frame = +3

Query: 219 PERDHRSHREGKEFKEGHFR 278
           P R H     GKE+K G  +
Sbjct: 85  PSRQHAGFEFGKEYKNGFIK 104


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -1

Query: 554  LRPHLKAGAAFLCW 513
            LRP+L+  AA L W
Sbjct: 1178 LRPYLRTAAAILTW 1191


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 12/33 (36%), Positives = 16/33 (48%)
 Frame = -3

Query: 183 AHGETRNAIRYPNGKEADNCTQMFHCFDITAPT 85
           AHG   +A RY  G  A   T +  CF+   P+
Sbjct: 445 AHGLPPSATRYDLGAVATVGTTVAPCFEEPLPS 477


>X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alpha
           protein.
          Length = 461

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 7/14 (50%), Positives = 9/14 (64%)
 Frame = -2

Query: 514 GYNLCIIPFVPVCG 473
           GYN   + FVP+ G
Sbjct: 182 GYNTASVAFVPISG 195


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 174,812
Number of Sequences: 438
Number of extensions: 3813
Number of successful extensions: 8
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19855845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -