SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20045
         (722 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    23   2.2  
EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.          21   8.9  
EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.      21   8.9  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   8.9  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   8.9  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   8.9  

>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 12/42 (28%), Positives = 18/42 (42%)
 Frame = +3

Query: 147 QVAYHDREAYFEEVHEGELVSVLLSHASADHVGARAIRVPLP 272
           Q   H R+    + H+G + S L     A   GA +  +P P
Sbjct: 218 QPGMHPRQQQQAQQHQGVVTSPLSQQQQAAPQGAASANLPSP 259


>EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.
          Length = 686

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -1

Query: 584 PQYSLDAMT*PFSKFENSLVEKM 516
           PQYS   +  P  KFE+  ++K+
Sbjct: 439 PQYSQSELQMPGVKFESVNIDKL 461


>EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.
          Length = 686

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -1

Query: 584 PQYSLDAMT*PFSKFENSLVEKM 516
           PQYS   +  P  KFE+  ++K+
Sbjct: 439 PQYSQSELQMPGVKFESVNIDKL 461


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 8/34 (23%), Positives = 20/34 (58%)
 Frame = +2

Query: 503  TAISTSSQQDYSRTLKMVTSWRLGNTVEVSTTFC 604
            T + T  ++  + T++++   R+G+ V  + T+C
Sbjct: 1174 TTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYC 1207


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 8/34 (23%), Positives = 20/34 (58%)
 Frame = +2

Query: 503  TAISTSSQQDYSRTLKMVTSWRLGNTVEVSTTFC 604
            T + T  ++  + T++++   R+G+ V  + T+C
Sbjct: 1170 TTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYC 1203


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = -3

Query: 207 IQVHLHELLQNRLPDHDRP 151
           +Q H H L    + DH RP
Sbjct: 144 LQNHHHHLQSTAVQDHHRP 162


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 213,041
Number of Sequences: 438
Number of extensions: 5170
Number of successful extensions: 12
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22413960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -