SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20040
         (701 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine beta-sy...    26   0.40 
DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    22   4.9  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   6.5  
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    22   6.5  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   8.6  

>AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine
           beta-synthase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 0.40
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSI 589
           ++ P   SW S  + +  A KL+ ++ NSI
Sbjct: 148 IRTPTEASWHSPEAHISVAQKLQKEIPNSI 177


>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 9/28 (32%), Positives = 17/28 (60%)
 Frame = -3

Query: 591 RMLLVTSLSSLRACSRADAPLSHDVFAG 508
           R+LL++++  +  CS  +  L  D+F G
Sbjct: 10  RILLISAVFCVGLCSEDEERLVRDLFRG 37


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 7/18 (38%), Positives = 14/18 (77%)
 Frame = +1

Query: 613  EQLQRLPPGRLFVRGIPR 666
            ++L++LP G LF++ + R
Sbjct: 1321 DRLRQLPEGSLFIKEVDR 1338


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 10/24 (41%), Positives = 11/24 (45%)
 Frame = +1

Query: 10  ANRTYLFEFPANYKSPSTPVCVKA 81
           A RTYLF+   N      P  V A
Sbjct: 545 AGRTYLFDLDYNESEEQCPYTVDA 568


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.4 bits (43), Expect = 8.6
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +1

Query: 547 RARPQAGE*RHQQHPGGHQDLREQLQRLPPG 639
           +A+PQ  + + QQ P   Q  ++Q Q+   G
Sbjct: 827 QAQPQQQQQQQQQQPQQQQQQQQQQQQQQRG 857


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,480
Number of Sequences: 438
Number of extensions: 3289
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21561255
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -