SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20030
         (713 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1al...   293   8e-82
X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alp...   288   4e-80
AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor 1-a...   188   3e-50
EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor 1-a...   173   1e-45
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    31   0.008
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    24   1.2  
AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    23   2.9  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    22   6.6  
AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    21   8.8  

>AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1alpha
           F2 protein.
          Length = 461

 Score =  293 bits (720), Expect = 8e-82
 Identities = 145/166 (87%), Positives = 147/166 (88%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE RFEEIKKE
Sbjct: 128 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKE 173



 Score =  134 bits (325), Expect = 6e-34
 Identities = 59/64 (92%), Positives = 61/64 (95%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPAAVAFVPISGWHGDNMLE S+KMPWFKGW VERKEGK +GKCLIEALDA
Sbjct: 175 SSYIKKIGYNPAAVAFVPISGWHGDNMLEVSSKMPWFKGWTVERKEGKVEGKCLIEALDA 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alpha
           protein.
          Length = 461

 Score =  288 bits (706), Expect = 4e-80
 Identities = 142/166 (85%), Positives = 145/166 (87%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGIGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLAFTLGVKQLIVGVNKMD T+PPYSE RFEEIKKE
Sbjct: 128 SKNGQTREHALLAFTLGVKQLIVGVNKMDMTDPPYSEARFEEIKKE 173



 Score =  126 bits (305), Expect = 2e-31
 Identities = 55/65 (84%), Positives = 60/65 (92%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYN A+VAFVPISGWHGDNMLEPS K PW+KGW+VERK+G ADGK LIEALDA
Sbjct: 175 SSYIKKIGYNTASVAFVPISGWHGDNMLEPSPKTPWYKGWKVERKDGNADGKTLIEALDA 234

Query: 690 ILPPA 704
           ILPP+
Sbjct: 235 ILPPS 239


>AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor
           1-alpha protein.
          Length = 274

 Score =  188 bits (459), Expect = 3e-50
 Identities = 95/116 (81%), Positives = 97/116 (83%)
 Frame = +1

Query: 160 WVLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVA 339
           WVLDKLKAERER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVA
Sbjct: 1   WVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 60

Query: 340 AGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           AGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE RFEEIKKE
Sbjct: 61  AGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKE 116



 Score =  134 bits (325), Expect = 6e-34
 Identities = 59/64 (92%), Positives = 61/64 (95%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPAAVAFVPISGWHGDNMLE S+KMPWFKGW VERKEGK +GKCLIEALDA
Sbjct: 118 SSYIKKIGYNPAAVAFVPISGWHGDNMLEVSSKMPWFKGWTVERKEGKVEGKCLIEALDA 177

Query: 690 ILPP 701
           ILPP
Sbjct: 178 ILPP 181


>EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor
           1-alpha protein.
          Length = 172

 Score =  173 bits (422), Expect = 1e-45
 Identities = 83/84 (98%), Positives = 83/84 (98%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI
Sbjct: 17  IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 76

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           VGVNKMDSTEPPYSE RFEEIKKE
Sbjct: 77  VGVNKMDSTEPPYSETRFEEIKKE 100



 Score =  134 bits (325), Expect = 6e-34
 Identities = 59/64 (92%), Positives = 61/64 (95%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPAAVAFVPISGWHGDNMLE S+KMPWFKGW VERKEGK +GKCLIEALDA
Sbjct: 102 SSYIKKIGYNPAAVAFVPISGWHGDNMLEVSSKMPWFKGWTVERKEGKVEGKCLIEALDA 161

Query: 690 ILPP 701
           ILPP
Sbjct: 162 ILPP 165



 Score = 37.5 bits (83), Expect = 1e-04
 Identities = 15/17 (88%), Positives = 16/17 (94%)
 Frame = +2

Query: 209 DIALWKFETSKYYVTTL 259
           DIALWKFETSKYYVT +
Sbjct: 1   DIALWKFETSKYYVTII 17


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 31.5 bits (68), Expect = 0.008
 Identities = 26/82 (31%), Positives = 36/82 (43%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  FI     G    D  VL+VAA  G  E       QT +   +A    V  +I
Sbjct: 198 LDTPGHAAFISMRHRGAHITDIVVLVVAADDGVKE-------QTLQSIEMAKDAKV-PII 249

Query: 436 VGVNKMDSTEPPYSEPRFEEIK 501
           V +NK+D       + ++E  K
Sbjct: 250 VAINKIDKPNIDIIKVQYELAK 271



 Score = 25.0 bits (52), Expect = 0.71
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKST 54
           RH I + ++GHVD GK+T
Sbjct: 144 RHPI-VTIMGHVDHGKTT 160


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
          methyltransferase protein.
          Length = 683

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 11/15 (73%), Positives = 11/15 (73%)
 Frame = +1

Query: 10 INIVVIGHVDSGKST 54
          INI  IGHV  GKST
Sbjct: 43 INIGTIGHVAHGKST 57


>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 8/25 (32%), Positives = 16/25 (64%)
 Frame = +1

Query: 154 YAWVLDKLKAERERRYHNRYCSLEV 228
           Y W+  + + +R R+ + RY +LE+
Sbjct: 261 YPWMRSQFERKRGRQTYTRYQTLEL 285


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 9/30 (30%), Positives = 14/30 (46%)
 Frame = -2

Query: 529 IFLMYEDLPS*FPQIWAHCMVVQWNPFCLL 440
           + L+   LP     IW+H   V    FC++
Sbjct: 100 LLLLISGLPPEIYYIWSHFPYVFGEAFCII 129


>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 8/24 (33%), Positives = 13/24 (54%)
 Frame = -1

Query: 608 FG*RLQHVVSVPSRNGHESDSSWV 537
           FG  L H++ V  +N   + + WV
Sbjct: 35  FGLSLHHIIDVDEKNQILTTNCWV 58


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 213,744
Number of Sequences: 438
Number of extensions: 4717
Number of successful extensions: 28
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22048515
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -