SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20029
         (715 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       41   1e-05
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          23   2.9  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      23   2.9  
AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.          23   2.9  
DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.               22   5.0  
DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor pro...    21   8.8  

>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 41.1 bits (92), Expect = 1e-05
 Identities = 15/62 (24%), Positives = 36/62 (58%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLI 247
           D+ ++   ++F   ++K D++   +   ++  +++HGD  QR+RE  +  F++G   +L+
Sbjct: 447 DSGTLGGTLVFVEMKKKADFIAVFLSENNYPTTSIHGDRLQRQREEALADFKSGRMSILV 506

Query: 248 TT 253
            T
Sbjct: 507 AT 508



 Score = 34.7 bits (76), Expect = 9e-04
 Identities = 14/24 (58%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D++ VS VINYDLP   + Y
Sbjct: 512 ARGLDIKNVSHVINYDLPKGIDEY 535


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 467 MWPTSSKAPTFFRFY 511
           MW TS + P FF  Y
Sbjct: 407 MWSTSLRDPVFFSIY 421


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 467 MWPTSSKAPTFFRFY 511
           MW TS + P FF  Y
Sbjct: 407 MWSTSLRDPVFFSIY 421


>AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.
          Length = 226

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 467 MWPTSSKAPTFFRFY 511
           MW TS + P FF  Y
Sbjct: 33  MWSTSLRDPVFFSIY 47


>DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.
          Length = 152

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 8/25 (32%), Positives = 12/25 (48%)
 Frame = -2

Query: 150 RRCIDSVSQSTLRRVLQKITACAID 76
           R+C+D+          QK + C ID
Sbjct: 99  RQCVDNAKNEDKCLTAQKFSRCVID 123


>DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor
           protein.
          Length = 405

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 7/16 (43%), Positives = 14/16 (87%)
 Frame = -1

Query: 280 VHQYHVPINSGDQDTR 233
           V+Q++  ++SG++DTR
Sbjct: 12  VYQWNHTVSSGERDTR 27


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 194,956
Number of Sequences: 438
Number of extensions: 4207
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22048515
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -