SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20027
         (779 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             25   1.0  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          23   3.2  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    22   5.6  
L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        21   9.7  
AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    21   9.7  
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    21   9.7  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 24.6 bits (51), Expect = 1.0
 Identities = 13/52 (25%), Positives = 26/52 (50%)
 Frame = +3

Query: 417 IPDAEAKSADIKVEEPAAQPEDSKTEVQATVLKFQKKKNLVLLMQKVLPTQL 572
           +P  EA    ++  + +A P D   ++ A   K  +  N+ LL Q+ +P ++
Sbjct: 489 LPPREAPLVGVQPHQDSATPADQPLDLSAKP-KNSQDNNISLLEQQKIPLRM 539


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 4/42 (9%)
 Frame = +1

Query: 229 PTEVAAATERRKPNLLQLVTTR----YPLYQRPKRTI*PQKT 342
           P  V+ ++  R+P   ++  T+    +P Y+RP+ T  P+ T
Sbjct: 130 PPSVSLSSPPREPGTPRINFTKLKRHHPRYKRPRTTFEPRAT 171


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 5/14 (35%), Positives = 11/14 (78%)
 Frame = -1

Query: 473  LSSWFFHFNISRFC 432
            +S+W +H N+++ C
Sbjct: 1674 MSTWGYHHNVNKHC 1687


>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = -3

Query: 420 ESRMILLPGLFLRFSL 373
           ES  +LLP ++LR++L
Sbjct: 249 ESEDVLLPSVYLRWNL 264


>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -1

Query: 257 LSVAAATSVGLTESSILGATS 195
           L+ A  TSVG+TE S+    S
Sbjct: 812 LTAAVQTSVGVTEISLASNAS 832


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -1

Query: 257 LSVAAATSVGLTESSILGATS 195
           L+ A  TSVG+TE S+    S
Sbjct: 902 LTAAVQTSVGVTEISLASNAS 922


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,743
Number of Sequences: 438
Number of extensions: 2813
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24518154
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -