SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20024
         (560 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    26   0.23 
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               23   1.6  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       23   2.8  
DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    22   4.9  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        22   4.9  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        22   4.9  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        22   4.9  
DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    21   6.4  
AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor pr...    21   6.4  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   8.5  

>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 26.2 bits (55), Expect = 0.23
 Identities = 11/34 (32%), Positives = 16/34 (47%)
 Frame = +3

Query: 303 QPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGA 404
           QPG    QQ  A  + G+  +P + +    P GA
Sbjct: 218 QPGMHPRQQQQAQQHQGVVTSPLSQQQQAAPQGA 251


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = +3

Query: 291 QHSFQPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYD 452
           Q  F+PG  LG+Q   +S P +       RG +   GA+G +  P V   +  D
Sbjct: 168 QMGFEPGKGLGKQLQGISTP-VEAHLRKGRGAI---GAYGPEKGPKVPEKKKED 217



 Score = 21.0 bits (42), Expect = 8.5
 Identities = 5/7 (71%), Positives = 6/7 (85%)
 Frame = -1

Query: 260 WYLGWPG 240
           WY+GW G
Sbjct: 674 WYMGWKG 680


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +1

Query: 220 NPANAPPPGQP 252
           NP+  PPPG P
Sbjct: 41  NPSQGPPPGGP 51


>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +3

Query: 405 FGYQSYPYVTPTQSYDTTIEWVPT 476
           F Y  Y Y   TQ+ ++ I  +PT
Sbjct: 27  FDYYFYDYSNRTQALESIIANIPT 50


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 8/27 (29%), Positives = 16/27 (59%)
 Frame = -2

Query: 238 VEHLQDCRAMGKLVLGVGDNLGFRMDI 158
           + ++Q  R +     GVG N+G+++ I
Sbjct: 135 INNVQGLRGLKSCHTGVGRNVGYKIPI 161


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 8/27 (29%), Positives = 16/27 (59%)
 Frame = -2

Query: 238 VEHLQDCRAMGKLVLGVGDNLGFRMDI 158
           + ++Q  R +     GVG N+G+++ I
Sbjct: 135 INNVQGLRGLKSCHTGVGRNVGYKIPI 161


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 8/27 (29%), Positives = 16/27 (59%)
 Frame = -2

Query: 238 VEHLQDCRAMGKLVLGVGDNLGFRMDI 158
           + ++Q  R +     GVG N+G+++ I
Sbjct: 135 INNVQGLRGLKSCHTGVGRNVGYKIPI 161


>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 21.4 bits (43), Expect = 6.4
 Identities = 6/14 (42%), Positives = 9/14 (64%)
 Frame = -1

Query: 296 MLNIITRHRIIWWY 255
           +L  +T HR  WW+
Sbjct: 18  ILIFVTSHRPAWWF 31


>AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor
           protein.
          Length = 501

 Score = 21.4 bits (43), Expect = 6.4
 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 1/48 (2%)
 Frame = -2

Query: 151 FSISVNLLLKFQNTR-NTYLITAQNSEFRDPTFRLGRYRSEILRHLFR 11
           F  S+ L L + N+  N  +    N +FR P   +  +R   L H+ R
Sbjct: 407 FLSSLFLWLGYCNSLLNPIIYATLNRDFRKPFREILYFRCSNLNHMMR 454


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.0 bits (42), Expect = 8.5
 Identities = 10/21 (47%), Positives = 11/21 (52%)
 Frame = +3

Query: 432 TPTQSYDTTIEWVPTTPQNAS 494
           T T +  TT    P T QNAS
Sbjct: 665 TTTTTTTTTTTTTPNTTQNAS 685


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 166,934
Number of Sequences: 438
Number of extensions: 3792
Number of successful extensions: 14
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16195212
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -