SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20021
         (476 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.          27   0.078
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        22   3.9  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        22   3.9  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        22   3.9  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   5.1  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   5.1  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    21   9.0  
AY739658-1|AAU85297.1|  664|Apis mellifera hyperpolarization-act...    21   9.0  
AY280848-1|AAQ16312.1|  632|Apis mellifera hyperpolarization-act...    21   9.0  

>DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.
          Length = 495

 Score = 27.5 bits (58), Expect = 0.078
 Identities = 20/78 (25%), Positives = 41/78 (52%)
 Frame = +1

Query: 46  EGSEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLV 225
           + +ED+ +N++  +  +K  ++    + G  L+   KV    +G SL+   LGI+CG  +
Sbjct: 419 DDNEDHDENMI--IPPKKSDMSNMQSDDGGPLSLKNKVETTHSGTSLFRINLGIECGYEI 476

Query: 226 SVVMKRLLSMYSPRAKAE 279
             +++  L + S  A +E
Sbjct: 477 KKLLRYKL-LISQNAVSE 493


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 3.9
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +2

Query: 317 CGVTTSPPRVILASVFKN 370
           C +   PPRVIL+S  K+
Sbjct: 626 CNLGLEPPRVILSSGAKS 643


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 3.9
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +2

Query: 317 CGVTTSPPRVILASVFKN 370
           C +   PPRVIL+S  K+
Sbjct: 626 CNLGLEPPRVILSSGAKS 643


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 3.9
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +2

Query: 317 CGVTTSPPRVILASVFKN 370
           C +   PPRVIL+S  K+
Sbjct: 626 CNLGLEPPRVILSSGAKS 643


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.4 bits (43), Expect = 5.1
 Identities = 6/15 (40%), Positives = 12/15 (80%)
 Frame = +3

Query: 225 IRRNEKIAVHVQSEG 269
           + RN+ +A+H Q++G
Sbjct: 721 VERNKHVALHCQAQG 735


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.4 bits (43), Expect = 5.1
 Identities = 6/15 (40%), Positives = 12/15 (80%)
 Frame = +3

Query: 225 IRRNEKIAVHVQSEG 269
           + RN+ +A+H Q++G
Sbjct: 717 VERNKHVALHCQAQG 731


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 20.6 bits (41), Expect = 9.0
 Identities = 5/15 (33%), Positives = 9/15 (60%)
 Frame = -2

Query: 154 WRHESACHRIHQHRC 110
           W+  ++ H +H H C
Sbjct: 88  WQRLTSLHELHVHGC 102


>AY739658-1|AAU85297.1|  664|Apis mellifera
           hyperpolarization-activated ion channelvariant L
           protein.
          Length = 664

 Score = 20.6 bits (41), Expect = 9.0
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = -3

Query: 291 SKDLFCFSPRTVHGQQSFHYDGYQ 220
           S++L     R  H   +FH D YQ
Sbjct: 641 SQELSREGRRIFHKSDTFHKDSYQ 664


>AY280848-1|AAQ16312.1|  632|Apis mellifera
           hyperpolarization-activated ion channel protein.
          Length = 632

 Score = 20.6 bits (41), Expect = 9.0
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = -3

Query: 291 SKDLFCFSPRTVHGQQSFHYDGYQ 220
           S++L     R  H   +FH D YQ
Sbjct: 609 SQELSREGRRIFHKSDTFHKDSYQ 632


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 130,750
Number of Sequences: 438
Number of extensions: 2754
Number of successful extensions: 9
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12928545
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -