SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20017
         (763 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     24   1.3  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    22   7.1  
DQ494419-1|ABF55370.1|  127|Apis mellifera telomerase reverse tr...    21   9.4  
DQ494418-1|ABF55369.1|  110|Apis mellifera telomerase reverse tr...    21   9.4  
AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone este...    21   9.4  
AY526235-1|AAS20468.1|  169|Apis mellifera esterase protein.           21   9.4  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    21   9.4  
AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.           21   9.4  

>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +1

Query: 337 HNSRYSDAPYFI 372
           HN +YS+ PYF+
Sbjct: 214 HNDKYSNVPYFL 225


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = +3

Query: 21  NTHNYQYPYPDLKNEVSSNY 80
           N +NY+Y Y +  N  ++NY
Sbjct: 92  NNNNYKYNYNNKYNYNNNNY 111


>DQ494419-1|ABF55370.1|  127|Apis mellifera telomerase reverse
           transcriptase protein.
          Length = 127

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 10/33 (30%), Positives = 17/33 (51%)
 Frame = -3

Query: 656 KHTDRKLTTAVVSFVLNSLRAGTGSF*WKWKNQ 558
           K T+ K+T  ++   L S +  +    +KW NQ
Sbjct: 67  KSTNEKITRYIIRMFLISQQKTSKLKIYKWNNQ 99


>DQ494418-1|ABF55369.1|  110|Apis mellifera telomerase reverse
           transcriptase protein.
          Length = 110

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 10/33 (30%), Positives = 17/33 (51%)
 Frame = -3

Query: 656 KHTDRKLTTAVVSFVLNSLRAGTGSF*WKWKNQ 558
           K T+ K+T  ++   L S +  +    +KW NQ
Sbjct: 50  KSTNEKITRYIIRMFLISQQKTSKLKIYKWNNQ 82


>AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone
           esterase protein.
          Length = 567

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 7/24 (29%), Positives = 13/24 (54%)
 Frame = -3

Query: 332 LIICIKYRPVRTHLRLLTTI*NYF 261
           +I C++YRP R  +  L     ++
Sbjct: 269 MIRCLRYRPARAIVETLANFMRFY 292


>AY526235-1|AAS20468.1|  169|Apis mellifera esterase protein.
          Length = 169

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 7/24 (29%), Positives = 13/24 (54%)
 Frame = -3

Query: 332 LIICIKYRPVRTHLRLLTTI*NYF 261
           +I C++YRP R  +  L     ++
Sbjct: 140 MIRCLRYRPARAIVETLANFMRFY 163


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = -2

Query: 663 SH*AHGS*ADHRSGELRFELAPS 595
           S+   G+ +DH  G LR+   PS
Sbjct: 265 SNMVEGNESDHNDGRLRYWRTPS 287


>AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.
          Length = 567

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 7/24 (29%), Positives = 13/24 (54%)
 Frame = -3

Query: 332 LIICIKYRPVRTHLRLLTTI*NYF 261
           +I C++YRP R  +  L     ++
Sbjct: 269 MIRCLRYRPARAIVETLANFMRFY 292


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 197,908
Number of Sequences: 438
Number of extensions: 4291
Number of successful extensions: 10
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 23789892
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -