SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20015
         (627 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated...    24   1.4  
DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate r...    24   1.4  
AB006152-1|BAA24504.1|  178|Apis mellifera inositol 1,4,5-tripho...    24   1.4  
DQ863218-1|ABI94394.1|  399|Apis mellifera tyramine receptor pro...    23   2.4  
DQ863217-1|ABI94393.1|  399|Apis mellifera tyramine receptor pro...    23   2.4  
AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled rec...    23   2.4  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    22   4.3  
Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1 p...    21   7.4  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    21   9.8  
DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex det...    21   9.8  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    21   9.8  

>DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 510

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +3

Query: 306 SPKIMTKKNTKVDIAQRIVWMDLEMTGLDIENDHI 410
           S K+M  + T  DI  R + M LE   ++ EN+ +
Sbjct: 19  SSKVMLTRGTVNDIVSRNITMVLENLLMNYENNQL 53


>DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate
           receptor protein.
          Length = 322

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 9/25 (36%), Positives = 13/25 (52%)
 Frame = -2

Query: 380 HFKIHPYNPLSYVNFSIFFRHYFRR 306
           H  +H Y PL      + FRH+ +R
Sbjct: 133 HLAMHDYPPLVSGALHLLFRHFSQR 157


>AB006152-1|BAA24504.1|  178|Apis mellifera inositol
           1,4,5-triphosphate recepter protein.
          Length = 178

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 9/25 (36%), Positives = 13/25 (52%)
 Frame = -2

Query: 380 HFKIHPYNPLSYVNFSIFFRHYFRR 306
           H  +H Y PL      + FRH+ +R
Sbjct: 101 HLAMHDYPPLVSGALHLLFRHFSQR 125


>DQ863218-1|ABI94394.1|  399|Apis mellifera tyramine receptor
           protein.
          Length = 399

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -2

Query: 359 NPLSYVNFSIFFRHYFRR 306
           NPL Y  F++ +R  FRR
Sbjct: 377 NPLIYTIFNLDYRRAFRR 394


>DQ863217-1|ABI94393.1|  399|Apis mellifera tyramine receptor
           protein.
          Length = 399

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -2

Query: 359 NPLSYVNFSIFFRHYFRR 306
           NPL Y  F++ +R  FRR
Sbjct: 377 NPLIYTIFNLDYRRAFRR 394


>AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled
           receptor protein.
          Length = 399

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -2

Query: 359 NPLSYVNFSIFFRHYFRR 306
           NPL Y  F++ +R  FRR
Sbjct: 377 NPLIYTIFNLDYRRAFRR 394


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = -3

Query: 160 CTTLHYIHTISEIY 119
           C TLH+ H   EIY
Sbjct: 467 CNTLHHWHHCPEIY 480


>Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1
           protein.
          Length = 402

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = -2

Query: 362 YNPLSYVNFSIFFRHYFRR 306
           +NP+ Y  F+  FR  F+R
Sbjct: 320 FNPIIYSIFNTEFREAFKR 338


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = +3

Query: 204 STCKVYFTLKQLHTT**IYVITKAITFLTRNLSMSP 311
           STC V    K +HT    Y+ + A++ L   +S  P
Sbjct: 73  STCVVIARNKSMHTATNYYLFSLAVSDLLLLISGLP 108


>DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex
           determiner protein.
          Length = 180

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 94  SNYNHDQVY*IALYIN 47
           SNYN+D  Y   LY N
Sbjct: 94  SNYNNDNNYNKKLYYN 109


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 8/20 (40%), Positives = 12/20 (60%)
 Frame = -1

Query: 411 LCGHFQCQVLSFQDPSIQSS 352
           L GH     L F+DP ++S+
Sbjct: 507 LKGHAHWLTLHFKDPKVESA 526


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 163,859
Number of Sequences: 438
Number of extensions: 3730
Number of successful extensions: 14
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18704709
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -