SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20014
         (597 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    25   0.75 
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    22   4.0  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    22   5.3  
DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protei...    21   6.9  
AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter...    21   6.9  
AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase pro...    21   6.9  
AY739659-1|AAU85298.1|  288|Apis mellifera hyperpolarization-act...    21   9.2  
AY739658-1|AAU85297.1|  664|Apis mellifera hyperpolarization-act...    21   9.2  
AY280848-1|AAQ16312.1|  632|Apis mellifera hyperpolarization-act...    21   9.2  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    21   9.2  
AB050744-1|BAB17753.1|  238|Apis mellifera period protein protein.     21   9.2  

>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 24.6 bits (51), Expect = 0.75
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -1

Query: 237 CPHGGKLLFGSEPFLN 190
           CP    +LF S PFLN
Sbjct: 383 CPESDSILFVSSPFLN 398


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 22.2 bits (45), Expect = 4.0
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = +3

Query: 45  KSESQNPRRAYGPCEIAS 98
           KS S +PR   GPC+  S
Sbjct: 880 KSPSPSPRPLVGPCKALS 897


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 7/19 (36%), Positives = 10/19 (52%)
 Frame = +3

Query: 258 MIKGVTKGFQYKMRAVYAH 314
           M++G+  G QY     Y H
Sbjct: 740 MLRGIASGMQYLAEMNYVH 758


>DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protein
           protein.
          Length = 424

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = -2

Query: 326 VNGEVSIHSTHLVLEAFSYSFNHVSTCE 243
           V  EVSI    L+    ++S+N V  C+
Sbjct: 91  VTREVSIDGNPLIAPYPNWSYNDVKYCD 118


>AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter
           transporter-1A protein.
          Length = 203

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = -2

Query: 539 FLISLFLTVVVAG 501
           FLI  FLT+V+AG
Sbjct: 19  FLIPYFLTLVLAG 31


>AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase
           protein.
          Length = 588

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 16/59 (27%), Positives = 27/59 (45%)
 Frame = +3

Query: 330 VTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQKDELIIRQLFRKMSLALVLSSS 506
           V  +GN  IEI N      +R+ +      ++N  K    + I +L  K + A + +SS
Sbjct: 476 VLKKGNFTIEILNKTVLAVVRQSEEEAVSLLINFSKNNTIVDISKLVNKRNNAKIYTSS 534


>AY739659-1|AAU85298.1|  288|Apis mellifera
           hyperpolarization-activated ion channelvariant T
           protein.
          Length = 288

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = +1

Query: 337 LRVIQLLRYVTSW 375
           LR+ +L+RYV+ W
Sbjct: 220 LRLSRLVRYVSQW 232


>AY739658-1|AAU85297.1|  664|Apis mellifera
           hyperpolarization-activated ion channelvariant L
           protein.
          Length = 664

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = +1

Query: 337 LRVIQLLRYVTSW 375
           LR+ +L+RYV+ W
Sbjct: 220 LRLSRLVRYVSQW 232


>AY280848-1|AAQ16312.1|  632|Apis mellifera
           hyperpolarization-activated ion channel protein.
          Length = 632

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = +1

Query: 337 LRVIQLLRYVTSW 375
           LR+ +L+RYV+ W
Sbjct: 220 LRLSRLVRYVSQW 232


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 8/19 (42%), Positives = 11/19 (57%)
 Frame = +3

Query: 9   GQTKPKHEANCSKSESQNP 65
           G+  P HE   SKS ++ P
Sbjct: 521 GEISPHHEYYDSKSSTETP 539


>AB050744-1|BAB17753.1|  238|Apis mellifera period protein protein.
          Length = 238

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 8/19 (42%), Positives = 11/19 (57%)
 Frame = +3

Query: 9   GQTKPKHEANCSKSESQNP 65
           G+  P HE   SKS ++ P
Sbjct: 219 GEISPHHEYYDSKSSTETP 237


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 165,244
Number of Sequences: 438
Number of extensions: 3520
Number of successful extensions: 11
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17482179
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -