SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20013
         (724 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1al...    93   3e-21
AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor 1-a...    92   4e-21
X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alp...    91   7e-21
EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor 1-a...    76   3e-16
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    33   0.003
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    32   0.005
AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    22   5.1  
AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    22   5.1  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    22   5.1  
AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    22   6.7  

>AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1alpha
           F2 protein.
          Length = 461

 Score = 92.7 bits (220), Expect = 3e-21
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGTGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 9e-12
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 43.2 bits (97), Expect = 3e-06
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E R+ E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIK 179


>AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor
           1-alpha protein.
          Length = 274

 Score = 92.3 bits (219), Expect = 4e-21
 Identities = 39/78 (50%), Positives = 55/78 (70%)
 Frame = +3

Query: 276 WALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVIS 455
           W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++
Sbjct: 1   WVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 60

Query: 456 ARKGEFETGFDRGGQTRD 509
           A  GEFE G  + GQTR+
Sbjct: 61  AGTGEFEAGISKNGQTRE 78



 Score = 43.2 bits (97), Expect = 3e-06
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E R+ E ++++  Y+K
Sbjct: 79  HALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIK 122


>X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alpha
           protein.
          Length = 461

 Score = 91.5 bits (217), Expect = 7e-21
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGIGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 9e-12
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 41.9 bits (94), Expect = 6e-06
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E R+ E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDMTDPPYSEARFEEIKKEVSSYIK 179


>EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor
           1-alpha protein.
          Length = 172

 Score = 76.2 bits (179), Expect = 3e-16
 Identities = 32/56 (57%), Positives = 42/56 (75%)
 Frame = +3

Query: 342 FETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQTRD 509
           FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE G  + GQTR+
Sbjct: 7   FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 62



 Score = 43.2 bits (97), Expect = 3e-06
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E R+ E ++++  Y+K
Sbjct: 63  HALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIK 106


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 33.1 bits (72), Expect = 0.003
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = +3

Query: 366 TILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           T LD PGH +F+     GA   D+ VLV++A  G
Sbjct: 196 TFLDTPGHAAFISMRHRGAHITDIVVLVVAADDG 229



 Score = 27.9 bits (59), Expect = 0.10
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = +1

Query: 85  KPPRVEDTRSKKEHVNVVFIGHVDAGKSTI 174
           K P   +++  K H  V  +GHVD GK+T+
Sbjct: 132 KRPLPNESQLIKRHPIVTIMGHVDHGKTTL 161


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 32.3 bits (70), Expect = 0.005
 Identities = 28/108 (25%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 7   EEELDTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQI 186
           EE L    G  N  +  +L+K    K      +  S++  +N+  IGHV  GKSTI   I
Sbjct: 4   EEGLGVTTGQPNLYKQ-DLSKLDVSKLTALSREVISRQATINIGTIGHVAHGKSTIVKAI 62

Query: 187 MSLTGMVDKRTLEK---YEREAREKSENHGTYHGHWTQIKKNETKAKQ 321
             +  +  K  LE+    + + R +    G    +     K  T+ K+
Sbjct: 63  SGVQTVRFKNELERNITIKLDTRAEDSTRGEQEANLGYTNKMSTRGKR 110


>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -2

Query: 597 FSSQLTVGSSILFTSATK 544
           F+S   VGSS+LF   TK
Sbjct: 474 FASHEVVGSSLLFVHDTK 491


>AF388659-2|AAK71994.1|  463|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
          Length = 463

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -2

Query: 597 FSSQLTVGSSILFTSATK 544
           F+S   VGSS+LF   TK
Sbjct: 389 FASHEVVGSSLLFVHDTK 406


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -2

Query: 597 FSSQLTVGSSILFTSATK 544
           F+S   VGSS+LF   TK
Sbjct: 708 FASHEVVGSSLLFVHDTK 725


>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 21.8 bits (44), Expect = 6.7
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -2

Query: 438 RGQLEQPHQSCLEQNFCVQGHQEL*NASFQSQ 343
           + Q +Q H    EQ+   Q  Q+   AS QSQ
Sbjct: 187 QSQAQQQHLQAHEQHMMYQQQQQSQAASQQSQ 218


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 189,759
Number of Sequences: 438
Number of extensions: 3721
Number of successful extensions: 20
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22413960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -