SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20005
         (763 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    27   0.25 
AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    25   0.77 
AB083010-1|BAC54131.1|  132|Apis mellifera fatty acid binding pr...    25   1.0  
AY273778-1|AAP33487.1|  427|Apis mellifera ultraspiracle protein...    23   2.3  
AF263459-1|AAF73057.1|  427|Apis mellifera ultraspiracle protein...    23   2.3  
DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.          23   3.1  
EF493864-1|ABP65286.1|  247|Apis mellifera triosephoshpate isome...    23   4.1  
D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.         22   5.4  
AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly pro...    22   5.4  
AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly pro...    22   5.4  
AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    22   5.4  
EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.      22   7.1  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    22   7.1  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   7.1  
AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    22   7.1  

>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 26.6 bits (56), Expect = 0.25
 Identities = 9/28 (32%), Positives = 16/28 (57%)
 Frame = -1

Query: 187  FAIKVYCSNFKVDTNCGYKGDVKCIFRK 104
            ++++  C NF  D+   + G   C+FRK
Sbjct: 1592 YSVRGLCGNFDHDSTNDFVGPKNCLFRK 1619


>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 25.0 bits (52), Expect = 0.77
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = -3

Query: 572 RPTDYSLPVSFPFSLLVPG*SENAYSTFNESFADVSTNF 456
           RP+D +    FPF +L  G    A+ +  ++FA   T++
Sbjct: 308 RPSDGATSEPFPFLMLPLGAGRPAFWSLRKAFARKKTDY 346


>AB083010-1|BAC54131.1|  132|Apis mellifera fatty acid binding
           protein protein.
          Length = 132

 Score = 24.6 bits (51), Expect = 1.0
 Identities = 16/67 (23%), Positives = 29/67 (43%), Gaps = 1/67 (1%)
 Frame = +1

Query: 280 VYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGE-QLAIEYQI 456
           +Y +     F+N +   +  EE     V+   + + C LD  + +  ++GE Q  IE + 
Sbjct: 49  LYTLKTTSPFKNTEIKFKLGEEFEEETVDGRKVKSVCTLDGNKLIQVQKGEKQTTIEREF 108

Query: 457 KFVETSA 477
              E  A
Sbjct: 109 SSTEMKA 115


>AY273778-1|AAP33487.1|  427|Apis mellifera ultraspiracle protein
           protein.
          Length = 427

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 12/24 (50%), Positives = 13/24 (54%)
 Frame = -2

Query: 216 AVSHICNLTFLPSRSIVRILKSIP 145
           AVSHICN T      +V   K IP
Sbjct: 230 AVSHICNATNKQLFQLVAWAKHIP 253


>AF263459-1|AAF73057.1|  427|Apis mellifera ultraspiracle protein
           protein.
          Length = 427

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 12/24 (50%), Positives = 13/24 (54%)
 Frame = -2

Query: 216 AVSHICNLTFLPSRSIVRILKSIP 145
           AVSHICN T      +V   K IP
Sbjct: 230 AVSHICNATNKQLFQLVAWAKHIP 253


>DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.
          Length = 495

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 8/19 (42%), Positives = 11/19 (57%)
 Frame = +1

Query: 196 ITNMGYCWSREIPYNNNSI 252
           +T  GYC   E+PY+   I
Sbjct: 320 VTLKGYCIDMEVPYSGTLI 338


>EF493864-1|ABP65286.1|  247|Apis mellifera triosephoshpate
           isomerase protein.
          Length = 247

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 8/39 (20%), Positives = 18/39 (46%)
 Frame = +1

Query: 310 ENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           E ++NW         A+  ++I G      + + ++KE+
Sbjct: 185 EKLRNWFSKNVNQTVAETVRIIYGGSVTAGNAKDLAKEK 223


>D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.
          Length = 432

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 11/41 (26%), Positives = 21/41 (51%)
 Frame = +2

Query: 80  GKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           G+  I++  S+D+F+    +T   D K   + +DG+    Q
Sbjct: 210 GEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQ 250


>AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 11/41 (26%), Positives = 21/41 (51%)
 Frame = +2

Query: 80  GKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           G+  I++  S+D+F+    +T   D K   + +DG+    Q
Sbjct: 210 GEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQ 250


>AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 11/41 (26%), Positives = 21/41 (51%)
 Frame = +2

Query: 80  GKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           G+  I++  S+D+F+    +T   D K   + +DG+    Q
Sbjct: 210 GEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQ 250


>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = -3

Query: 338 MFLIQFLMFSKLFSFVTS*TSIIPIEPRSMLLLLYGI 228
           MF    ++FS + +F    + I P+E  SML  +Y +
Sbjct: 419 MFDSVSILFSDVVTFTEICSRITPMEVVSMLNAMYSL 455


>EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.
          Length = 686

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +3

Query: 39  IVYSNYF*SEIREWEKHQYYLDF 107
           IV +NY    +RE+   +Y LD+
Sbjct: 201 IVNTNYSSKNMREYNDPEYKLDY 223


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -1

Query: 250 CCCYCTESL 224
           CCC+C ++L
Sbjct: 11  CCCWCCDNL 19


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -2

Query: 213 VSHICNLTFLPSRSI 169
           +  I NLTFLP RS+
Sbjct: 878 IGFIGNLTFLPLRSL 892


>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 3/53 (5%)
 Frame = +2

Query: 572 GRSGVHKPTLNDARKPVTWLSRCSVL*PRLHTTTPAPA---LF*HCGTLNCPP 721
           GR  VH  + N + +     SRCSV   ++  +   P+   L   C TL   P
Sbjct: 310 GRGSVHNGSNNGSPRSPESNSRCSVKREKIKISVSYPSTETLNTKCNTLERTP 362


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 215,706
Number of Sequences: 438
Number of extensions: 4783
Number of successful extensions: 17
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 23789892
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -