SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20001
         (745 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM158085-1|CAJ43389.1|  171|Apis mellifera globin 1 protein.           27   0.14 
AM158084-1|CAJ43388.1|  171|Apis mellifera globin 1 protein.           27   0.14 
AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.     22   5.3  
DQ435330-1|ABD92645.1|  132|Apis mellifera OBP13 protein.              22   7.0  
AB208108-1|BAE72140.1|   92|Apis mellifera Broad complex zinc fi...    21   9.2  

>AM158085-1|CAJ43389.1|  171|Apis mellifera globin 1 protein.
          Length = 171

 Score = 27.5 bits (58), Expect = 0.14
 Identities = 15/36 (41%), Positives = 18/36 (50%)
 Frame = -3

Query: 503 VITAFCTVCQDKLRQFPSFS*APWN*LPRGKRFCLH 396
           V+TAF     +  R F +F   P N LP  KRF  H
Sbjct: 50  VMTAFFKKYPEYQRYFTAFMDTPLNELPANKRFQAH 85


>AM158084-1|CAJ43388.1|  171|Apis mellifera globin 1 protein.
          Length = 171

 Score = 27.5 bits (58), Expect = 0.14
 Identities = 15/36 (41%), Positives = 18/36 (50%)
 Frame = -3

Query: 503 VITAFCTVCQDKLRQFPSFS*APWN*LPRGKRFCLH 396
           V+TAF     +  R F +F   P N LP  KRF  H
Sbjct: 50  VMTAFFKKYPEYQRYFTAFMDTPLNELPANKRFQAH 85


>AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.
          Length = 602

 Score = 22.2 bits (45), Expect = 5.3
 Identities = 12/31 (38%), Positives = 15/31 (48%)
 Frame = +3

Query: 528 QRQATKDAGTISGLNVLRIINEPTAAAIAYG 620
           Q +A K A  +   N   II+EPT     YG
Sbjct: 353 QAEAEKHAAMLYQYNFNIIISEPTERISPYG 383


>DQ435330-1|ABD92645.1|  132|Apis mellifera OBP13 protein.
          Length = 132

 Score = 21.8 bits (44), Expect = 7.0
 Identities = 11/36 (30%), Positives = 21/36 (58%)
 Frame = -1

Query: 283 FGIEYCVVGVIATWFLAASPMRRSVSVNAT*DGVVL 176
           F   +C+VG++A    + + +R+  SV A  +G+ L
Sbjct: 6   FIFAFCLVGILAVSEESINKLRKIESVCAEENGIDL 41


>AB208108-1|BAE72140.1|   92|Apis mellifera Broad complex zinc
          finger domain-Z3 isoform protein.
          Length = 92

 Score = 21.4 bits (43), Expect = 9.2
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = -2

Query: 75 PFCIFNQSCYLFLKQ 31
          P+C  N SCY  LK+
Sbjct: 9  PYCRRNFSCYYSLKR 23


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 220,531
Number of Sequences: 438
Number of extensions: 5156
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23266665
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -