SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30166.Seq
         (892 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    26   0.40 
DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.           24   2.1  
AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    23   2.8  
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    23   2.8  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             23   2.8  
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    23   3.7  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    23   4.9  
DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex det...    22   8.6  
AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex det...    22   8.6  

>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 26.2 bits (55), Expect = 0.40
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = +3

Query: 510 DQSSARAKTFLSTAQVVDD-QVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY 671
           D S + A   +  AQ+V+  Q   I+S+++++ E +  D  V LFK F++++  Y
Sbjct: 389 DSSRSFALKQMKKAQIVETRQQQHIMSEKRIMGEADC-DFVVKLFKTFKDRKYLY 442


>DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.
          Length = 552

 Score = 23.8 bits (49), Expect = 2.1
 Identities = 14/51 (27%), Positives = 23/51 (45%)
 Frame = -2

Query: 435 SRGASLLLQPTDDVISLTTT*IVDRTAIPEEFESRVSSYTVALGEILFLSC 283
           ++G  L   P   +  LTT  ++ +  IP+E     S YT  + +I    C
Sbjct: 270 AKGGKLACPPAIFIFDLTTDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDC 320


>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = -3

Query: 215 VPEICSGRTMEHRIQLKCTPWL*LQFQS 132
           +P++CSG    + I L   P L L F++
Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = -3

Query: 215 VPEICSGRTMEHRIQLKCTPWL*LQFQS 132
           +P++CSG    + I L   P L L F++
Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 2/28 (7%)
 Frame = -2

Query: 786 SPPKESWKPVSGGEF--XDS*PCSGQPP 709
           SPP E WKP+    F      P   QPP
Sbjct: 415 SPPPEDWKPLDKCYFCLDGKLPHDDQPP 442


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 23.0 bits (47), Expect = 3.7
 Identities = 15/39 (38%), Positives = 19/39 (48%)
 Frame = +2

Query: 224 AKAATKLAEEDLLSN*RKLTQLKNRISPRATVYEDTRLS 340
           A +  K   +DLLSN  +L +     S R TV    RLS
Sbjct: 17  ANSEAKRLYDDLLSNYNRLIRPVGNNSDRLTVKMGLRLS 55


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 8/28 (28%), Positives = 14/28 (50%)
 Frame = -3

Query: 239 LLLPWRIPVPEICSGRTMEHRIQLKCTP 156
           L + W  P+ EI     +  R +++C P
Sbjct: 435 LSISWDAPITEIGGDSDLVERYEVRCYP 462


>DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
 Frame = +3

Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320
           +L    + N + R+  R+Q S+  +  YQ        R+  R E  RC
Sbjct: 29  LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76


>DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
 Frame = +3

Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320
           +L    + N + R+  R+Q S+  +  YQ        R+  R E  RC
Sbjct: 29  LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76


>DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
 Frame = +3

Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320
           +L    + N + R+  R+Q S+  +  YQ        R+  R E  RC
Sbjct: 29  LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76


>DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
 Frame = +3

Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320
           +L    + N + R+  R+Q S+  +  YQ        R+  R E  RC
Sbjct: 29  LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76


>DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
 Frame = +3

Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320
           +L    + N + R+  R+Q S+  +  YQ        R+  R E  RC
Sbjct: 29  LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76


>DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
 Frame = +3

Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320
           +L    + N + R+  R+Q S+  +  YQ        R+  R E  RC
Sbjct: 29  LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76


>DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
 Frame = +3

Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320
           +L    + N + R+  R+Q S+  +  YQ        R+  R E  RC
Sbjct: 29  LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76


>AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex
           determiner protein.
          Length = 385

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 11/44 (25%), Positives = 21/44 (47%)
 Frame = +3

Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRRE 311
           +L    +   + R+  R+Q+S+  + SY+        R+  RRE
Sbjct: 262 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRRE 305


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 231,639
Number of Sequences: 438
Number of extensions: 4592
Number of successful extensions: 40
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 39
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28783482
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -