SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30165.Seq
         (897 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    26   0.41 
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    26   0.41 
S76957-1|AAB33932.1|  169|Apis mellifera olfactory receptor prot...    22   6.6  
S76956-1|AAB33931.1|  168|Apis mellifera olfactory receptor prot...    22   6.6  
DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450 monoo...    22   6.6  
AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.      22   8.7  

>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 26.2 bits (55), Expect = 0.41
 Identities = 13/41 (31%), Positives = 17/41 (41%)
 Frame = -2

Query: 293 VCAPPQRRTPHRQISVHFFGRGNRRCLFGRHKEAHGHFVVF 171
           V AP         +SVH  G    RC    H +A  HF+ +
Sbjct: 327 VTAPLHVEVTPPLLSVHLGGNAEFRCEVSTHPQAGPHFITW 367



 Score = 22.6 bits (46), Expect = 5.0
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = +1

Query: 643 SPQHGSVLPPVGAXHSGGPTE 705
           +P H  V PP+ + H GG  E
Sbjct: 329 APLHVEVTPPLLSVHLGGNAE 349


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 26.2 bits (55), Expect = 0.41
 Identities = 13/41 (31%), Positives = 17/41 (41%)
 Frame = -2

Query: 293 VCAPPQRRTPHRQISVHFFGRGNRRCLFGRHKEAHGHFVVF 171
           V AP         +SVH  G    RC    H +A  HF+ +
Sbjct: 327 VTAPLHVEVTPPLLSVHLGGNAEFRCEVSTHPQAGPHFITW 367



 Score = 22.6 bits (46), Expect = 5.0
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = +1

Query: 643 SPQHGSVLPPVGAXHSGGPTE 705
           +P H  V PP+ + H GG  E
Sbjct: 329 APLHVEVTPPLLSVHLGGNAE 349


>S76957-1|AAB33932.1|  169|Apis mellifera olfactory receptor
           protein.
          Length = 169

 Score = 22.2 bits (45), Expect = 6.6
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = -3

Query: 553 YTVAMSLRCRVRLLFPPYATRL 488
           Y+VAMS R  ++L+  PY   L
Sbjct: 12  YSVAMSQRLCIQLVVGPYVIGL 33


>S76956-1|AAB33931.1|  168|Apis mellifera olfactory receptor
           protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 6.6
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = -3

Query: 553 YTVAMSLRCRVRLLFPPYATRL 488
           Y+VAMS R  ++L+  PY   L
Sbjct: 11  YSVAMSQRLCIQLVVGPYVIGL 32


>DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 499

 Score = 22.2 bits (45), Expect = 6.6
 Identities = 8/19 (42%), Positives = 14/19 (73%)
 Frame = -1

Query: 378 SQRQSLGLEVFGINFLYVL 322
           S+ + +G EVF +NF+ V+
Sbjct: 203 SEFRRMGREVFAVNFMNVM 221


>AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.
          Length = 429

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +1

Query: 625 LRRRXESPQHGSVLPP 672
           L  R   P HG++LPP
Sbjct: 353 LAMRLSHPLHGNLLPP 368


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 213,203
Number of Sequences: 438
Number of extensions: 4166
Number of successful extensions: 18
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29025360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -