SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30163.Seq
         (824 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    25   0.64 
AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    23   2.6  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    23   4.5  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    23   4.5  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    22   7.9  

>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
           protein protein.
          Length = 138

 Score = 25.4 bits (53), Expect = 0.64
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +1

Query: 334 DGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           DG+ V    VA E GF+  G   P   P+
Sbjct: 81  DGQQVSITYVADENGFQVQGSHIPTAPPI 109


>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
           protein.
          Length = 1308

 Score = 23.4 bits (48), Expect = 2.6
 Identities = 11/43 (25%), Positives = 20/43 (46%)
 Frame = +1

Query: 220 QRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAV 348
           +R+EW++ H+     E    HQ        +K V S+   +A+
Sbjct: 726 RRKEWLYLHRARSESEFEMYHQQLQGVAKNKKNVGSMSRNKAL 768


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 22.6 bits (46), Expect = 4.5
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = -1

Query: 794 PCCWFEXC 771
           PCCW++ C
Sbjct: 487 PCCWWKIC 494


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 22.6 bits (46), Expect = 4.5
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = -1

Query: 794 PCCWFEXC 771
           PCCW++ C
Sbjct: 540 PCCWWKIC 547


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 21.8 bits (44), Expect = 7.9
 Identities = 11/39 (28%), Positives = 17/39 (43%)
 Frame = +1

Query: 529 DVVDPRPTKGVHKEMRVKKEALYHLSAFFPSQFSRWTPW 645
           DVV+ +P K        K   + H + FF +   +  PW
Sbjct: 438 DVVELQPVKSSKSSGWRKLRNIVHWTPFFQTYKKQRYPW 476


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 173,092
Number of Sequences: 438
Number of extensions: 2834
Number of successful extensions: 11
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26338809
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -