SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30161.Seq
         (888 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       32   0.008
AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    24   1.6  
DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.              23   2.8  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   6.5  
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    22   6.5  

>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 31.9 bits (69), Expect = 0.008
 Identities = 23/65 (35%), Positives = 28/65 (43%), Gaps = 5/65 (7%)
 Frame = -1

Query: 849 SSXNQGXPPKP-MKPSAG--GXKPRASVAPVPGRSPGAGTRAIXS--VVSPLNXXHQISM 685
           SS   G  P P   P A   G  P  S  P PG  PGA      S  ++SP +  HQ+  
Sbjct: 17  SSGAPGPQPSPHQSPQAPQRGSPPNPSQGPPPGGPPGAPPSQNPSQMMISPASGIHQMQQ 76

Query: 684 LARFH 670
           L + H
Sbjct: 77  LLQQH 81


>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +3

Query: 15  CSSYFPQSGSFIITLVTFTKDK*Y 86
           CS  F QSG  +I + T T +K Y
Sbjct: 181 CSKTFIQSGQLVIHMRTHTGEKPY 204


>DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.
          Length = 145

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 19/65 (29%), Positives = 26/65 (40%), Gaps = 3/65 (4%)
 Frame = -1

Query: 426 SLLQGFLECHIAAHCFRRQSFNLVSFPAELGQFIDAFILYDGRVYIEANAVR---CPEQL 256
           SLL   L C  + HC  R SF      A     ++A     G   ++  AVR    PE  
Sbjct: 8   SLLITCLICSPSVHCGTRPSFVSDEMIATAASVVNACQTQTGVATVDIEAVRNGQWPETR 67

Query: 255 RTVCW 241
           +  C+
Sbjct: 68  QLKCY 72


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 6/24 (25%), Positives = 15/24 (62%)
 Frame = +3

Query: 603 IPTINIFANRLKFYFNGEYAGFDE 674
           + T+++  NR+  ++NG +   D+
Sbjct: 456 LKTLDLGENRISNFYNGSFRNLDQ 479


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 10/19 (52%), Positives = 11/19 (57%)
 Frame = +2

Query: 533 RSHRISSFGRIQESNRTGR 589
           RSHR  S  R Q SN+  R
Sbjct: 70  RSHRFKSLPRCQLSNKRDR 88


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 228,855
Number of Sequences: 438
Number of extensions: 4722
Number of successful extensions: 8
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28662543
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -