SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30160.Seq
         (904 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF051030-1|ABN05618.1|  118|Apis mellifera phosphoenolpyruvate c...    64   1e-12
M29490-1|AAA27725.1|  109|Apis mellifera protein ( Bee homeobox-...    24   2.2  
M29489-1|AAA27724.1|  109|Apis mellifera protein ( Bee homeobox-...    23   5.0  
DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated...    22   8.8  

>EF051030-1|ABN05618.1|  118|Apis mellifera phosphoenolpyruvate
           carboxykinase protein.
          Length = 118

 Score = 64.5 bits (150), Expect = 1e-12
 Identities = 31/39 (79%), Positives = 33/39 (84%)
 Frame = +3

Query: 501 IVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           I+ ITNP+GKKRYI AAFPSACGKTNLAMM P T PG K
Sbjct: 1   ILAITNPKGKKRYITAAFPSACGKTNLAMMKP-TLPGYK 38



 Score = 37.9 bits (84), Expect = 1e-04
 Identities = 21/46 (45%), Positives = 25/46 (54%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFGSCXQVXSXGN 742
           PGYK+ CVGDDIA MKF  +    R  +  + GFFG      S  N
Sbjct: 35  PGYKIECVGDDIAWMKF-DKEGRLRA-INPEYGFFGVAPGTSSATN 78


>M29490-1|AAA27725.1|  109|Apis mellifera protein ( Bee
           homeobox-containing gene,partial cds, clone E30. ).
          Length = 109

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = -2

Query: 342 GRRANPECHRSRLREDNERTARLDVEFLELR 250
           G+  +PE  R R     E+ ARL  EF E R
Sbjct: 13  GKNGSPEEKRPRTAFSAEQLARLKREFAENR 43


>M29489-1|AAA27724.1|  109|Apis mellifera protein ( Bee
           homeobox-containing gene,partial cds, clone E60. ).
          Length = 109

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 13/31 (41%), Positives = 14/31 (45%)
 Frame = -2

Query: 342 GRRANPECHRSRLREDNERTARLDVEFLELR 250
           G    PE  R R     E+ ARL  EF E R
Sbjct: 13  GNGGTPEEKRPRTAFSGEQLARLKREFAENR 43


>DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 469

 Score = 21.8 bits (44), Expect = 8.8
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 123 WTHNVRDTIL 152
           WTHNV D +L
Sbjct: 163 WTHNVLDMVL 172


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 235,492
Number of Sequences: 438
Number of extensions: 5078
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29267238
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -