SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30156.Seq
         (961 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    23   4.1  
AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     23   5.4  
AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    22   7.2  
AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex det...    22   7.2  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   7.2  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    22   9.5  

>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 23.0 bits (47), Expect = 4.1
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +1

Query: 244 LLVFLPIKEFEIIDFFLGP 300
           + VFL + EF +++ ++GP
Sbjct: 285 VFVFLSLMEFAVVNNYMGP 303


>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 22.6 bits (46), Expect = 5.4
 Identities = 8/33 (24%), Positives = 18/33 (54%)
 Frame = -1

Query: 262 LVKKQVNALEFVDFSFANKTAEFGDRNPLFLVF 164
           ++ + +++ + V++     T   GD  P+FL F
Sbjct: 352 MLVQDISSPDAVEYGIIGPTTCMGDHKPVFLEF 384


>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 22.2 bits (45), Expect = 7.2
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +2

Query: 401 TVILVWV*SAARKSPL 448
           T++LVW  SAA  SP+
Sbjct: 306 TILLVWAISAAIGSPI 321


>AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex
           determiner protein.
          Length = 410

 Score = 22.2 bits (45), Expect = 7.2
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = +1

Query: 172 ERVGSCHQTRPSCSRRKNRQTRE 240
           +   S +    SCSR +NR+ RE
Sbjct: 225 QHTSSRYSRERSCSRDRNREYRE 247


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 22.2 bits (45), Expect = 7.2
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = -2

Query: 711  PXKLERCXQIXVTPSPSER 655
            P + ER   + ++PSPS+R
Sbjct: 1366 PERPERVPTVDLSPSPSDR 1384


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 21.8 bits (44), Expect = 9.5
 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%)
 Frame = +1

Query: 184 SCHQTRP-SCSRRKNRQTRE 240
           S H +R  SCSR +NR+ +E
Sbjct: 228 SSHYSRERSCSRDRNREYKE 247


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 230,790
Number of Sequences: 438
Number of extensions: 4913
Number of successful extensions: 47
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 47
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 31565079
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -