SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30155.Seq
         (883 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex det...    26   0.40 
AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex det...    26   0.40 
AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex det...    26   0.40 
AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex det...    26   0.40 
AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex det...    26   0.40 
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    26   0.53 
DQ325105-1|ABD14119.1|  180|Apis mellifera complementary sex det...    25   0.70 
DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex det...    25   0.70 
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    25   0.70 
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    25   0.70 
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    25   0.70 
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    25   0.70 
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    25   0.70 
AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    25   0.70 
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    25   0.70 
DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex det...    25   0.92 
DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex det...    25   0.92 
DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex det...    25   0.92 
DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex det...    25   0.92 
DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex det...    25   0.92 
DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex det...    25   0.92 
DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex det...    25   0.92 
DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex det...    25   0.92 
DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex det...    25   0.92 
DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex det...    25   0.92 
DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex det...    25   0.92 
DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex det...    25   0.92 
DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex det...    25   0.92 
DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex det...    25   0.92 
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    25   0.92 
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    25   0.92 
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    25   0.92 
DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex det...    25   0.92 
DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex det...    25   0.92 
DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex det...    25   0.92 
DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex det...    25   0.92 
DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex det...    25   0.92 
DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex det...    25   0.92 
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    25   0.92 
AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex det...    25   0.92 
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    25   0.92 
DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex det...    24   1.6  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    23   2.8  
AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex det...    23   2.8  
DQ325130-1|ABD14144.1|  174|Apis mellifera complementary sex det...    23   4.9  
DQ325129-1|ABD14143.1|  174|Apis mellifera complementary sex det...    23   4.9  
DQ325128-1|ABD14142.1|  174|Apis mellifera complementary sex det...    23   4.9  
DQ325127-1|ABD14141.1|  174|Apis mellifera complementary sex det...    23   4.9  
DQ325126-1|ABD14140.1|  174|Apis mellifera complementary sex det...    23   4.9  
DQ325125-1|ABD14139.1|  174|Apis mellifera complementary sex det...    23   4.9  
DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex det...    23   4.9  
DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex det...    23   4.9  
DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex det...    23   4.9  
DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex det...    23   4.9  
DQ325109-1|ABD14123.1|  177|Apis mellifera complementary sex det...    23   4.9  
DQ325108-1|ABD14122.1|  177|Apis mellifera complementary sex det...    23   4.9  
DQ325107-1|ABD14121.1|  176|Apis mellifera complementary sex det...    23   4.9  
DQ325106-1|ABD14120.1|  177|Apis mellifera complementary sex det...    23   4.9  
DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex det...    23   4.9  
DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex det...    23   4.9  
DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex det...    23   4.9  
DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex det...    23   4.9  
DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex det...    23   4.9  
AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex det...    23   4.9  
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    22   6.5  
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    22   6.5  
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    22   6.5  
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    22   6.5  
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    22   6.5  
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    22   6.5  
DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex det...    22   6.5  
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    22   6.5  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    22   6.5  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    22   6.5  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    22   8.6  
DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex det...    22   8.6  
DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex det...    22   8.6  
DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex det...    22   8.6  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    22   8.6  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    22   8.6  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    22   8.6  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    22   8.6  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    22   8.6  

>AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 26.2 bits (55), Expect = 0.40
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P +FPR +PP+A
Sbjct: 368 IQEQIPRFRYIGPPTSFPRFIPPNA 392


>AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 26.2 bits (55), Expect = 0.40
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P +FPR +PP+A
Sbjct: 368 IQEQIPRFRYIGPPTSFPRFIPPNA 392


>AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 26.2 bits (55), Expect = 0.40
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P +FPR +PP+A
Sbjct: 368 IQEQIPRFRYIGPPTSFPRFIPPNA 392


>AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 26.2 bits (55), Expect = 0.40
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P +FPR +PP+A
Sbjct: 368 IQEQIPRLRYIGPPTSFPRFIPPNA 392


>AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 26.2 bits (55), Expect = 0.40
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P +FPR +PP+A
Sbjct: 357 IQEQIPRFRYIGPPTSFPRFIPPNA 381


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 25.8 bits (54), Expect = 0.53
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P  FPR +PP+A
Sbjct: 366 IQEQIPRFRHIGPPTPFPRFIPPNA 390


>DQ325105-1|ABD14119.1|  180|Apis mellifera complementary sex
           determiner protein.
          Length = 180

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P  FPR +PP+A
Sbjct: 140 IQEQIPRFRYIGPPTPFPRFIPPNA 164


>DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex
           determiner protein.
          Length = 180

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P  FPR +PP+A
Sbjct: 140 IQEQIPRFRYIGPPTPFPRFIPPNA 164


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P  FPR +PP+A
Sbjct: 386 IQEQIPRFRYIGPPTPFPRFIPPNA 410


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P  FPR +PP+A
Sbjct: 356 IQEQIPRFRYIGPPTPFPRFIPPNA 380


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P  FPR +PP+A
Sbjct: 367 IQEQIPRFRYIGPPTPFPRFIPPNA 391


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P  FPR +PP+A
Sbjct: 367 IQEQIPRFRYIGPPTPFPRFIPPNA 391


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P  FPR +PP+A
Sbjct: 356 IQEQIPRFRYIGPPTPFPRFIPPNA 380


>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P  FPR +PP+A
Sbjct: 378 IQEQIPRFRYIGPPTPFPRFIPPNA 402


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG P  FPR +PP+A
Sbjct: 388 IQEQIPRFRYIGPPTPFPRFIPPNA 412


>DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 141 EQIPRFRYIGPPTPFPRFIPPNA 163


>DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 141 EQIPRFRYIGPPTPFPRFIPPNA 163


>DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 141 EQIPRFRYIGPPTPFPRFIPPNA 163


>DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E + + + IG P  FPR +PP+A
Sbjct: 141 IQEQVPRFRYIGPPTPFPRFIPPNA 165


>DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E + + + IG P  FPR +PP+A
Sbjct: 141 IQEQVPRFRYIGPPTPFPRFIPPNA 165


>DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E + + + IG P  FPR +PP+A
Sbjct: 141 IQEQVPRFRYIGPPTPFPRFIPPNA 165


>DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E + + + IG P  FPR +PP+A
Sbjct: 141 IQEQVPRFRYIGPPTPFPRFIPPNA 165


>DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E + + + IG P  FPR +PP+A
Sbjct: 141 IQEQVPRFRYIGPPTPFPRFIPPNA 165


>DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E + + + IG P  FPR +PP+A
Sbjct: 145 IQEQVPRFRYIGPPTPFPRFIPPNA 169


>DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E + + + IG P  FPR +PP+A
Sbjct: 141 IQEQVPRFRYIGPPTPFPRFIPPNA 165


>DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 137 EQIPRFRYIGPPTPFPRFIPPNA 159


>DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 137 EQIPRFRYIGPPTPFPRFIPPNA 159


>DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 137 EQIPRFRYIGPPTPFPRFIPPNA 159


>DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 137 EQIPRFRYIGPPTPFPRFIPPNA 159


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 148 EQIPRFRYIGPPTPFPRFIPPNA 170


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 148 EQIPRFRYIGPPTPFPRFIPPNA 170


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 151 EQIPRFRYIGPPTPFPRFIPPNA 173


>DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 141 EQIPRFRYIGPPTPFPRFIPPNA 163


>DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 146 EQIPRFRYIGPPTPFPRFIPPNA 168


>DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 146 EQIPRFRYIGPPTPFPRFIPPNA 168


>DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 146 EQIPRFRYIGPPTPFPRFIPPNA 168


>DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 143 EQIPRFRYIGPPTPFPRFIPPNA 165


>DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex
           determiner protein.
          Length = 191

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 153 EQIPRFRYIGPPTPFPRFIPPNA 175


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 362 EQIPRFRYIGPPTPFPRFIPPNA 384


>AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E + + + IG P  FPR +PP+A
Sbjct: 366 IQEQVPRFRYIGPPTPFPRFIPPNA 390


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 25.0 bits (52), Expect = 0.92
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG P  FPR +PP+A
Sbjct: 376 EQIPRFRYIGPPTPFPRFIPPNA 398


>DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -3

Query: 647 IGVPRTFPRKVPPDA 603
           IG P  FPR +PP+A
Sbjct: 151 IGPPTPFPRFIPPNA 165


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG   +FPR +PP+A
Sbjct: 368 IQEQIPRFRHIGPSTSFPRFIPPNA 392


>AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPD 606
           E I + + IG P  FPR +PP+
Sbjct: 362 EQIPRFRYIGPPTPFPRFIPPN 383


>DQ325130-1|ABD14144.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 134 IQEQIPRFRHIGPSTPFPRFIPPNA 158


>DQ325129-1|ABD14143.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 134 IQEQIPRFRHIGPSTPFPRFIPPNA 158


>DQ325128-1|ABD14142.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 134 IQEQIPRFRHIGPSTPFPRFIPPNA 158


>DQ325127-1|ABD14141.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 134 IQEQIPRFRHIGPSTPFPRFIPPNA 158


>DQ325126-1|ABD14140.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 134 IQEQIPRFRHIGPSTLFPRFIPPNA 158


>DQ325125-1|ABD14139.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 134 IQEQIPRFRHIGPSTPFPRFIPPNA 158


>DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 145 IQEQIPRFRHIGPSTPFPRFIPPNA 169


>DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 145 IQEQIPRFRHIGPSTPFPRFIPPNA 169


>DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 145 IQEQIPRFRHIGPSTPFPRFIPPNA 169


>DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 145 IQEQIPRFRHIGPSTPFPRFIPPNA 169


>DQ325109-1|ABD14123.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 137 IQEQIPRFRHIGPSTPFPRFIPPNA 161


>DQ325108-1|ABD14122.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 137 IQEQIPRFRHIGPSTPFPRFIPPNA 161


>DQ325107-1|ABD14121.1|  176|Apis mellifera complementary sex
           determiner protein.
          Length = 176

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 137 IQEQIPRFRHIGPSTPFPRFIPPNA 161


>DQ325106-1|ABD14120.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 137 IQEQIPRFRHIGPSTPFPRFIPPNA 161


>DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 143 IQEQIPRFRHIGPSTPFPRFIPPNA 167


>DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 140 IQEQIPRFRHIGPSTPFPRFIPPNA 164


>DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 140 IQEQIPRFRHIGPSTPFPRFIPPNA 164


>DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 140 IQEQIPRFRHIGPSTPFPRFIPPNA 164


>DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 140 IQEQIPRFRHIGPSTPFPRFIPPNA 164


>AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex
           determiner protein.
          Length = 410

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 370 IQEQIPRFRHIGPSTPFPRFIPPNA 394


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 145 EQIPRFRHIGPSTPFPRFIPPNA 167


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 145 EQIPRFRHIGPSTPFPRFIPPNA 167


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 145 EQIPRFRHIGPSTPFPRFIPPNA 167


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 145 EQIPRFRHIGPSTPFPRFIPPNA 167


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 145 EQIPRFRHIGPSTPFPRFIPPNA 167


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 145 EQIPRFRHIGPSTPFPRFIPPNA 167


>DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex
           determiner protein.
          Length = 186

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 148 EQIPRFRHIGPSTPFPRFIPPNA 170


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 357 IQEQIPRFRYIGPSTPFPRFIPPNA 381


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 368 IQEQIPRFRYIGPSTPFPRFIPPNA 392


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 387 EQIPRFRHIGPSTPFPRFIPPNA 409


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/37 (27%), Positives = 18/37 (48%)
 Frame = -1

Query: 256 CL*GILPISAYWLKNELI*QKFNANFNKILTLTICHS 146
           CL  I+   ++W+K E    +       +LTL+  H+
Sbjct: 256 CLIVIMSWVSFWIKPEAAPARVTLGVTSLLTLSTQHA 292


>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 143 EQIPRFRYIGPSTPFPRFIPPNA 165


>DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 151 EQIPRFRYIGPSTPFPRFIPPNA 173


>DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 151 EQIPRFRYIGPSTPFPRFIPPNA 173


>DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex
           determiner protein.
          Length = 178

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 138 IQEQIPRFRHIGPLTPFPRFIPPNA 162


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 143 EQIPRFRYIGPSTPFPRFIPPNA 165


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 143 EQIPRFRYIGPSTPFPRFIPPNA 165


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 143 EQIPRFRYIGPSTPFPRFIPPNA 165


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 143 EQIPRFRYIGPSTPFPRFIPPNA 165


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 143 EQIPRFRYIGPSTPFPRFIPPNA 165


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 143 EQIPRFRYIGPSTPFPRFIPPNA 165


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 143 EQIPRFRYIGPSTPFPRFIPPNA 165


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 143 EQIPRFRYIGPSTPFPRFIPPNA 165


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDA 603
           I E I + + IG    FPR +PP+A
Sbjct: 379 IQEQIPRFRHIGPLTPFPRFIPPNA 403


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 376 EQIPRFRYIGPSTPFPRFIPPNA 398


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -3

Query: 671 ECI*KNKQIGVPRTFPRKVPPDA 603
           E I + + IG    FPR +PP+A
Sbjct: 376 EQIPRFRYIGPSTPFPRFIPPNA 398


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 238,732
Number of Sequences: 438
Number of extensions: 5598
Number of successful extensions: 95
Number of sequences better than 10.0: 90
Number of HSP's better than 10.0 without gapping: 94
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 95
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28644972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -