SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30153.Seq
         (864 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    22   8.4  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    22   8.4  

>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.8 bits (44), Expect = 8.4
 Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%)
 Frame = +2

Query: 266 WGNV-WPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVI 427
           W  V W G   +  S  P  +    + +G   PG     +    PN   L+ P +
Sbjct: 225 WKGVKWTGKVVYFTSLFPYALLTILLIRGLTLPGAMEGLKYYVTPNLSKLSDPEV 279


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.8 bits (44), Expect = 8.4
 Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%)
 Frame = +2

Query: 266 WGNV-WPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVI 427
           W  V W G   +  S  P  +    + +G   PG     +    PN   L+ P +
Sbjct: 278 WKGVKWTGKVVYFTSLFPYALLTILLIRGLTLPGAMEGLKYYVTPNLSKLSDPEV 332


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 238,234
Number of Sequences: 438
Number of extensions: 5326
Number of successful extensions: 8
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27916710
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -