SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30152.Seq
         (877 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.      38   2e-04
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          33   0.005
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             25   0.69 
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    24   2.1  
AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    23   3.7  
AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone este...    23   4.9  
AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.           23   4.9  
AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    22   6.5  

>AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.
          Length = 429

 Score = 37.5 bits (83), Expect = 2e-04
 Identities = 16/31 (51%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A DG S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACDGRSLKAHRVVLSACSPYFRELLKST 64


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 32.7 bits (71), Expect = 0.005
 Identities = 22/79 (27%), Positives = 33/79 (41%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A + AS   H+ +LSACS YF  L  +    +  + ++   V               
Sbjct: 38  VTLACNEASLKAHKVVLSACSSYFQKLLLSN-PCKHPTIIMPQDVCFNDLKFIIEFVYRG 96

Query: 444 XIDVTDTNVHELLMTADYL 500
            IDV+   +  LL TAD L
Sbjct: 97  EIDVSQAELQSLLKTADQL 115


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 25.4 bits (53), Expect = 0.69
 Identities = 15/62 (24%), Positives = 26/62 (41%)
 Frame = +3

Query: 171 SDGGSGNRSVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFT 350
           ++GG+       G +DA  P+T   + A   +  A    + P   + + A S    A+ T
Sbjct: 197 ANGGAARDESKAGSTDASTPATVTTTGATTTLPAASATGTGPATPSAVVATSNATAAMTT 256

Query: 351 TT 356
            T
Sbjct: 257 GT 258


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 23.8 bits (49), Expect = 2.1
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = +2

Query: 632 LLRYFVTVATQSDEFLHLPLDELNSIILED 721
           LLRYF ++AT   E   L L   +  + ED
Sbjct: 832 LLRYFASIATNPKEQAQLNLLASDPAVYED 861


>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 23.0 bits (47), Expect = 3.7
 Identities = 12/42 (28%), Positives = 21/42 (50%)
 Frame = -1

Query: 373 CSRE*RVVVNSARKYGLQAESIARCTGKEAPSSARTIASQAD 248
           CS E  +++  ARKY +Q +SI     +     + T+A   +
Sbjct: 414 CSSE-VMMLRMARKYDVQTDSIIFANNQPYTKDSYTVAGMGE 454


>AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone
           esterase protein.
          Length = 567

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%)
 Frame = -1

Query: 355 VVVNSARKYGLQAESIARC-TGKEAPSSARTIASQADDTRAVDGAPASLPPTCTDRFPDP 179
           V+++S   +G   E   R  T   A      I+       A +G P +LPP    RF  P
Sbjct: 7   VLLSSLVTFGWTLEDAPRVKTPLGAIKGYYKISGNGKQYEAYEGIPYALPPVGKFRFKAP 66


>AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.
          Length = 567

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%)
 Frame = -1

Query: 355 VVVNSARKYGLQAESIARC-TGKEAPSSARTIASQADDTRAVDGAPASLPPTCTDRFPDP 179
           V+++S   +G   E   R  T   A      I+       A +G P +LPP    RF  P
Sbjct: 7   VLLSSLVTFGWTLEDAPRVKTPLGAIKGYYKISGNGKQYEAYEGIPYALPPVGKFRFKAP 66


>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
            protein.
          Length = 1308

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = -1

Query: 874  GKICVVEQSPSSNAAQLI 821
            G+   ++QSPSSN +Q I
Sbjct: 1044 GQTIFIKQSPSSNQSQQI 1061


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 235,897
Number of Sequences: 438
Number of extensions: 5309
Number of successful extensions: 12
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28402218
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -