SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30147.Seq
         (878 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor 1-a...   299   3e-83
AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1al...   299   3e-83
EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor 1-a...   295   3e-82
X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alp...   285   3e-79
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    36   5e-04
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    24   1.6  
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    24   2.1  
DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    23   3.7  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    23   3.7  
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    23   4.9  
DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    22   8.6  

>AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor
           1-alpha protein.
          Length = 274

 Score =  299 bits (733), Expect = 3e-83
 Identities = 143/195 (73%), Positives = 155/195 (79%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ
Sbjct: 16  IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 75

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPAAVAFVP
Sbjct: 76  TREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVP 135

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLE S+KMPWFKGW VERKEGK +GKCLIEALDAILPP RP       P + 
Sbjct: 136 ISGWHGDNMLEVSSKMPWFKGWTVERKEGKVEGKCLIEALDAILPPTRPTDKALRLPLQD 195

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 196 VYKIGGIGTVPVGRV 210



 Score = 27.5 bits (58), Expect = 0.17
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = +3

Query: 213 WVLDKLKAERE 245
           WVLDKLKAERE
Sbjct: 1   WVLDKLKAERE 11


>AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1alpha
           F2 protein.
          Length = 461

 Score =  299 bits (733), Expect = 3e-83
 Identities = 143/195 (73%), Positives = 155/195 (79%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPAAVAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLE S+KMPWFKGW VERKEGK +GKCLIEALDAILPP RP       P + 
Sbjct: 193 ISGWHGDNMLEVSSKMPWFKGWTVERKEGKVEGKCLIEALDAILPPTRPTDKALRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 4e-37
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor
           1-alpha protein.
          Length = 172

 Score =  295 bits (724), Expect = 3e-82
 Identities = 138/168 (82%), Positives = 147/168 (87%)
 Frame = +1

Query: 259 DIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 438
           DIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT
Sbjct: 1   DIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 60

Query: 439 REHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPI 618
           REHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPAAVAFVPI
Sbjct: 61  REHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVPI 120

Query: 619 SGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARP 762
           SGWHGDNMLE S+KMPWFKGW VERKEGK +GKCLIEALDAILPP RP
Sbjct: 121 SGWHGDNMLEVSSKMPWFKGWTVERKEGKVEGKCLIEALDAILPPTRP 168


>X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alpha
           protein.
          Length = 461

 Score =  285 bits (700), Expect = 3e-79
 Identities = 136/195 (69%), Positives = 153/195 (78%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGIGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMD  +         + +++     +++GYN A+VAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDMTDPPYSEARFEEIKKEVSSYIKKIGYNTASVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS K PW+KGW+VERK+G ADGK LIEALDAILPP+RP       P + 
Sbjct: 193 ISGWHGDNMLEPSPKTPWYKGWKVERKDGNADGKTLIEALDAILPPSRPTDKALRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 4e-37
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 35.9 bits (79), Expect = 5e-04
 Identities = 27/73 (36%), Positives = 34/73 (46%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           VT +D PGH  FI     G    D  VL+VAA  G  E       QT +   +A    V 
Sbjct: 195 VTFLDTPGHAAFISMRHRGAHITDIVVLVVAADDGVKE-------QTLQSIEMAKDAKV- 246

Query: 478 QLIVGVNKMDSLN 516
            +IV +NK+D  N
Sbjct: 247 PIIVAINKIDKPN 259



 Score = 25.4 bits (53), Expect = 0.70
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKST 107
           K H  + ++GHVD GK+T
Sbjct: 143 KRHPIVTIMGHVDHGKTT 160


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 11/15 (73%), Positives = 11/15 (73%)
 Frame = +3

Query: 63  INIVVIGHVDSGKST 107
           INI  IGHV  GKST
Sbjct: 43  INIGTIGHVAHGKST 57


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 23.8 bits (49), Expect = 2.1
 Identities = 11/35 (31%), Positives = 18/35 (51%)
 Frame = -2

Query: 631 RAIQKWARKRQQLGCSPIFLMYEDTSFLISSNLGS 527
           +A +KWA     + C    L  +DT   ++ +LGS
Sbjct: 652 QAFRKWAADTFAVACETFCLDDDDTLLEVALSLGS 686


>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 23.0 bits (47), Expect = 3.7
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -2

Query: 55  FSLPIFG*SRITNCV*Y 5
           FSLPIFG   I +C+ Y
Sbjct: 57  FSLPIFGTRWIFSCIGY 73


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 23.0 bits (47), Expect = 3.7
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = +1

Query: 283 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 384
           T KYY    D P +  FIKN+   ++ +D   LI
Sbjct: 294 TMKYYDYGADFPFNFAFIKNVSRDSNSSDFKKLI 327


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +1

Query: 283 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 384
           T KYY    D P +  FIKN+   ++ +D   L+
Sbjct: 294 TMKYYDYGADFPFNFAFIKNVSRDSNSSDFKKLV 327


>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = -1

Query: 878 DNNGTWFSTHQFQILPD 828
           D N +  S H+FQILP+
Sbjct: 294 DENLSQNSYHEFQILPE 310


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 250,164
Number of Sequences: 438
Number of extensions: 5336
Number of successful extensions: 32
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28523595
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -