SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30141.Seq
         (897 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    26   0.54 
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    24   2.2  
DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor pro...    24   2.2  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    24   2.2  
AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    23   5.0  
DQ435325-1|ABD92640.1|  160|Apis mellifera OBP7 protein.               22   8.7  
AY739659-1|AAU85298.1|  288|Apis mellifera hyperpolarization-act...    22   8.7  
AY739658-1|AAU85297.1|  664|Apis mellifera hyperpolarization-act...    22   8.7  
AY280848-1|AAQ16312.1|  632|Apis mellifera hyperpolarization-act...    22   8.7  

>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 25.8 bits (54), Expect = 0.54
 Identities = 15/57 (26%), Positives = 29/57 (50%)
 Frame = +3

Query: 219 LVSGYGRPTYIPEVMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFL 389
           +VS Y   +Y+ E +  N +   +E  +G+  T +  + C  ++ DE+  +   QFL
Sbjct: 289 VVSDYSDYSYLDEKLERNDLD--LEKYEGISSTPSQASSCSCLDCDEIRESLDTQFL 343


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = +1

Query: 154 IVSGGCFGPTTKRTIVGGWAWAW 222
           IV+G    PT    + GG AW+W
Sbjct: 153 IVNGKRVPPTNWVGVFGGSAWSW 175


>DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor
           protein.
          Length = 405

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 9/29 (31%), Positives = 15/29 (51%)
 Frame = -2

Query: 176 PKQPPETISASLGPTVWMLPILNPFTVTF 90
           P +PP+ +  +L    W+   +NPF   F
Sbjct: 333 PVEPPDILMPALTWLGWINSAINPFIYAF 361


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = +1

Query: 154 IVSGGCFGPTTKRTIVGGWAWAW 222
           IV+G    PT    + GG AW+W
Sbjct: 153 IVNGKRVPPTNWVGVFGGSAWSW 175


>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = -2

Query: 791 GAFLKF*RVSVVLQFWVSIEYFDVH 717
           G +L F  + V L  W+++   +VH
Sbjct: 313 GKYLLFTMILVTLSIWITVCVLNVH 337


>DQ435325-1|ABD92640.1|  160|Apis mellifera OBP7 protein.
          Length = 160

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = +3

Query: 39  IKQVCYRFSCEVQCVYRESHCKRIQNGQ 122
           IK+    +SC + C   +SH   IQN +
Sbjct: 68  IKKYLTNYSCFITCALEKSHI--IQNDE 93


>AY739659-1|AAU85298.1|  288|Apis mellifera
           hyperpolarization-activated ion channelvariant T
           protein.
          Length = 288

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 9/36 (25%), Positives = 17/36 (47%)
 Frame = -1

Query: 651 QRPSSRWPLRTSPSWPRYWTSS*TSLIVKDRISIPI 544
           Q+ +  W +    S+  YW      L+V + I +P+
Sbjct: 73  QKAAGHWVIHPCSSFRFYWDLCMLLLLVANLIILPV 108


>AY739658-1|AAU85297.1|  664|Apis mellifera
           hyperpolarization-activated ion channelvariant L
           protein.
          Length = 664

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 9/36 (25%), Positives = 17/36 (47%)
 Frame = -1

Query: 651 QRPSSRWPLRTSPSWPRYWTSS*TSLIVKDRISIPI 544
           Q+ +  W +    S+  YW      L+V + I +P+
Sbjct: 73  QKAAGHWVIHPCSSFRFYWDLCMLLLLVANLIILPV 108


>AY280848-1|AAQ16312.1|  632|Apis mellifera
           hyperpolarization-activated ion channel protein.
          Length = 632

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 9/36 (25%), Positives = 17/36 (47%)
 Frame = -1

Query: 651 QRPSSRWPLRTSPSWPRYWTSS*TSLIVKDRISIPI 544
           Q+ +  W +    S+  YW      L+V + I +P+
Sbjct: 73  QKAAGHWVIHPCSSFRFYWDLCMLLLLVANLIILPV 108


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 270,652
Number of Sequences: 438
Number of extensions: 6183
Number of successful extensions: 15
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29025360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -